FGF-18 Protein, Rat
Based on 1 Customer Validation
FGF-18 Protein, Rat is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF-18 Protein, Rat is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.
Background
Fibroblast growth factor 18 (FGF18), a secreted heparin-binding polypeptide growth factor, is related to FGF8 and 175 and has been shown to have a number of functions in different organs. FGF18 is involved in cartilage growth and maturation and is implicated in the development of functional cartilage and bone tissue. It is also involved in processes within mature cartilage10-13 as well as being shown to have a role in enhancing regeneration and repair[1]. Fibroblast growth factor 18 (FGF18) acts as an important role in skeletal growth and limb development, potentially through the modulation of osteoblasts, chondrocytes, and osteoclasts[2].
Verified Bioactivity
1.The ED50 is <0.5 µg/mL as measured by 3T3 cells, corresponding to a specific activity of > 2.0 × 103 units/mg.
2.Measured by its binding ability in a functional ELISA. Immobilized Rat FGF18 at 10 μg/mL (100 μL/well) can bind Biotinylated Rat FGFR4 protein. The ED50 for this effect is <0.47 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
O88182 (E28-R199)
-
Molecular Construction
-
N-term
-
FGF-18 (E28-R199)
Accession # O88182 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FGF18; ZFGF5; Fibroblast Growth Factor 18; Fibroblast Growth Factor; FGF-18; FGF
-
AA Sequence
EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQTELQKPFKYTTVTKRSR
-
Predicted Molecular Mass
20.1 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under non reducing (N) conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Barr L, et al. The effect of recombinant human fibroblast growth factor-18 on articular cartilage following single impact load. J Orthop Res. 2014 Jul;32(7):923-7. [Content Brief]
[2]. Chen T, et al. Fibroblast growth factor 18 promotes proliferation and migration of H460 cells via the ERK and p38 signaling pathways. Oncol Rep. 2017 Feb;37(2):1235-1242. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)