FGF-19 Protein, Human

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Fibroblast growth factor 19 (FGF19, also called FGF15 in rodents) is a member of a subfamily of fibroblast growth factors that govern nutrient metabolism. FGF19 binds to a receptor complex composed of the FGF receptor 4 (FGFR4) and a coreceptor called β-Klotho, which are both highly expressed in liver. FGF19 is an enterokine synthesized and released when bile acids are taken up into the ileum. FGF19 stimulates hepatic protein and glycogen synthesis but does not induce lipogenesis. FGF19 activates a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism^[1].

The ED₅₀ is <288.5 ng/mL as measured by murine Balb/c 3T3 cells, corresponding to a specific activity of >3.46 × 10³ units/mg.

• 
  Measured in a cell proliferation assay using murine Balb/c 3T3 cells. The ED₅₀ for this effect is 67.56 ng/mL, corresponding to a specific activity is 1.48×10⁴ units/mg.

Human

E. coli

Tag Free

O95750 (R23-K216)

9965  [NCBI]

Full Length of Mature Protein

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Approximately 21-27 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kir S, et al. FGF19 as a postprandial, insulin-independent activator of hepatic protein and glycogen synthesis. Science. 2011 Mar 25;331(6024):1621-4.  [Content Brief]