1. Recombinant Proteins
  2. FGF-2 Protein, Rat

FGF-2 Protein, Rat

Cat. No.: HY-P7091
Handling Instructions

FGF-2 Protein, Rat is a growth factor and signaling protein encoded by the FGF2 gene.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $90 In-stock
Estimated Time of Arrival: December 31
50 μg $190 In-stock
Estimated Time of Arrival: December 31
100 μg $290 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE FGF-2 Protein, Rat

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rRtbFGF; HBGF-2; FGF-2; FGF-b; FGF-basic
Species

Rat

Source

E. coli

Accession

P13109 (P10-S154)

Gene ID

54250

Molecular Weight

Approximately 16.4 kDa

AA Sequence

GPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Biological Activity
The ED50 is <0.25 ng/mL as measured by 3T3 cells, corresponding to a specific activity of > 4.0 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant Rat Basic Fibroblast Growth Factor is a potent mitogen and chemoattractant for endothelial cells as well as fibroblasts. Basic fibroblast growth factor (bFGF) is a heparin-binding mitogen for mesoderm-derived cells, also acts as a mitogen, differentiation inducing and maintenance factor for many neuroectodermal cells including glial cells, neurons, paraneurons, and their tumor counterparts. The molecule is expressed in several types of neuroectodermal cells. bFGF occurs in many neuronal target tissues, and can prevent ontogenetic as well as lesion-induced neuron death[1]. In vitro, basic fibroblast growth factor induces an angiogenic phenotype in endothelial cells, which includes chemotaxis, mitogenesis, protease production, beta-integrin expression, and tube formation in three-dimensional gels. It acts by binding to specific tyrosine kinase receptors and to cell-associated heparan sulfate proteoglycans[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-2 Protein, Rat
Cat. No.:
HY-P7091
Quantity:
MCE Japan Authorized Agent: