1. Recombinant Proteins
  2. FGF-23 Protein, Human

FGF-23 Protein, Human

Cat. No.: HY-P7013
Handling Instructions

FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $440 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuFGF-23; Phosphatonin; Tumor-derived hypophosphatemia-inducing factor
Species

Human

Source

E. coli

Accession

Q9GZV9 (Y25-F251)

Gene ID

8074

Molecular Weight

Approximately 25.3 kDa

AA Sequence

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Biological Activity
The ED50 is <0.5 μg/mL as measured by FGF-receptors transfected BaF3 cells, corresponding to a specific activity of >2.0 × 103 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant Human Fibroblast Growth Factor 23 is a unique FGF subfamily member, acts as a a hormone and requires a cofactor to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis[1]. FGF23 is a secreted, circulating protein of 32 kDa that is predominantly produced by osteocytesin bone and functions in distant target organs in an endocrine fashion. FGF23 generally requires an FGF receptor (FGFR) and α-Klotho to evoke its signaling. GF23 binds to an FGFR-α-Klotho complex and induces the phosphorylation of FGFR and the expression of early growth response-1 (Egr-1), which encodes a transcription factor[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-23 Protein, Human
Cat. No.:
HY-P7013
Quantity:
MCE Japan Authorized Agent: