FGF-23 Protein, Human

FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.

Recombinant Human Fibroblast Growth Factor 23 is a unique FGF subfamily member, acts as a a hormone and requires a cofactor to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis^[1]. FGF23 is a secreted, circulating protein of 32 kDa that is predominantly produced by osteocytesin bone and functions in distant target organs in an endocrine fashion. FGF23 generally requires an FGF receptor (FGFR) and α-Klotho to evoke its signaling. GF23 binds to an FGFR-α-Klotho complex and induces the phosphorylation of FGFR and the expression of early growth response-1 (Egr-1), which encodes a transcription factor^[2].

The ED₅₀ is <0.5 μg/mL as measured by FGF-receptors transfected BaF3 cells, corresponding to a specific activity of >2.0 × 10³ units/mg.

Human

E. coli

Tag Free

Q9GZV9 (Y25-F251)

8074  [NCBI]

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Approximately 25.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Guibert M, et al. Fibroblast-growth factor 23 promotes terminal differentiation of ATDC5 cells. PLoS One. 2017 Apr 13;12(4):e0174969.  [Content Brief]

  [2]. Ohata Y, et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J Bone Miner Res. 2014 Jul;29(7):1627-38.  [Content Brief]