Copy Link Print Information

FGF-23 Protein, Human

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • FGF-23 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.

Background

Recombinant Human Fibroblast Growth Factor 23 is a unique FGF subfamily member, acts as a a hormone and requires a cofactor to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis[1]. FGF23 is a secreted, circulating protein of 32 kDa that is predominantly produced by osteocytesin bone and functions in distant target organs in an endocrine fashion. FGF23 generally requires an FGF receptor (FGFR) and α-Klotho to evoke its signaling. GF23 binds to an FGFR-α-Klotho complex and induces the phosphorylation of FGFR and the expression of early growth response-1 (Egr-1), which encodes a transcription factor[2].

Verified Bioactivity

The ED50 is <0.5 μg/mL as measured by FGF-receptors transfected BaF3 cells, corresponding to a specific activity of >2.0 × 103 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q9GZV9 (Y25-F251)

  • Gene ID
    8074  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-23 (Y25-F251)
      Accession # Q9GZV9
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF23; FGF-23; Fibroblast Growth Factor 23; HFTC2; Phosphatonin; HPDR2; HYPF; PHPTC; Tumor-Derived Hypophosphatemia Inducing Factor; ADHR; Tumor-Derived Hypophosphatemia-Inducing Factor; FGFN

  • AA Sequence

    YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

  • Predicted Molecular Mass

    25.3 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Guibert M, et al. Fibroblast-growth factor 23 promotes terminal differentiation of ATDC5 cells. PLoS One. 2017 Apr 13;12(4):e0174969. [Content Brief]

[2]. Ohata Y, et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J Bone Miner Res. 2014 Jul;29(7):1627-38. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FGF-23 Protein, Human Product Image
    1/16
  • FGF-23 Protein, Human Product Image