FGF-23 Protein, Human
Based on 2 publication(s) in Google Scholar
FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.
Background
Recombinant Human Fibroblast Growth Factor 23 is a unique FGF subfamily member, acts as a a hormone and requires a cofactor to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis[1]. FGF23 is a secreted, circulating protein of 32 kDa that is predominantly produced by osteocytesin bone and functions in distant target organs in an endocrine fashion. FGF23 generally requires an FGF receptor (FGFR) and α-Klotho to evoke its signaling. GF23 binds to an FGFR-α-Klotho complex and induces the phosphorylation of FGFR and the expression of early growth response-1 (Egr-1), which encodes a transcription factor[2].
Verified Bioactivity
The ED50 is <0.5 μg/mL as measured by FGF-receptors transfected BaF3 cells, corresponding to a specific activity of >2.0 × 103 units/mg.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cancer Cell
Paneth-like transition drives resistance to dual targeting of KRAS and EGFR in colorectal cancer. [Abstract]2025 Nov 13:S1535-6108(25)00451-9. PMID: 41237766 -
J Clin Invest
Kidney glycolysis serves as a mammalian phosphate sensor that maintains phosphate homeostasis. [Abstract]2023 Apr 17;133(8):e164610. PMID: 36821389
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9GZV9 (Y25-F251)
-
Molecular Construction
-
N-term
-
FGF-23 (Y25-F251)
Accession # Q9GZV9 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF23; FGF-23; Fibroblast Growth Factor 23; HFTC2; Phosphatonin; HPDR2; HYPF; PHPTC; Tumor-Derived Hypophosphatemia Inducing Factor; ADHR; Tumor-Derived Hypophosphatemia-Inducing Factor; FGFN
-
AA Sequence
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
-
Predicted Molecular Mass
25.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Guibert M, et al. Fibroblast-growth factor 23 promotes terminal differentiation of ATDC5 cells. PLoS One. 2017 Apr 13;12(4):e0174969. [Content Brief]
[2]. Ohata Y, et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J Bone Miner Res. 2014 Jul;29(7):1627-38. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)