Copy Link Print Information

FGF-12 Protein, Canine

Customer Review

Based on 1 Customer Validation

FGF-12 forms complexes with signaling proteins regulates the cytoskeletal system, binds to FGF receptors, activates signaling cascades to prevent apoptosis and interacts with ribosome biogenetic complexes. FGF-12 has been linked to neurological diseases, cancer and heart disease, making it a potential target and therapeutic agent for gene therapy. FGF-12 Protein, Canine is the recombinant canine-derived FGF-12 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-12 Protein, Canine
  • Experimental Validation Results for FGF-12 Protein, Canine
  • FGF-12 Protein, Canine Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-12 forms complexes with signaling proteins regulates the cytoskeletal system, binds to FGF receptors, activates signaling cascades to prevent apoptosis and interacts with ribosome biogenetic complexes. FGF-12 has been linked to neurological diseases, cancer and heart disease, making it a potential target and therapeutic agent for gene therapy. FGF-12 Protein, Canine is the recombinant canine-derived FGF-12 protein, expressed by E. coli , with tag free.

Background

FGF family members have a wide range of mitotic and cell survival activities and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. Fibroblast growth factor 12 (FGF12) belongs to the fibroblast growth factor Homologous factor (FHF) subfamily, also known as the FGF11 subfamily. FGF12 is a key player in nervous system development and function, exerting its influence by positively regulating the activity of voltage-gated sodium channels. FGF12 forms complexes with signaling proteins regulates the cytoskeletal system, binds to FGF receptors, activates signaling cascades to prevent apoptosis and interacts with ribosome biogenetic complexes. FGF12 has been linked to neurological diseases, cancer and heart disease, making it a potential target and therapeutic agent for gene therapy[1][2].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized FGFR4 at 2 μg/mL (100 μL/well) can bind Biotinylated FGF-12. The ED50 for this effect is 1.505 µg/mL.

Technical Parameters

  • Species Canine
  • Source E. coli
  • Tag Tag Free
  • Accession

    A0A5F4CAA4 (M1-T181)

  • Gene ID
    478676  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-12 (M1-T181)
      Accession # A0A5F4CAA4
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FGF12; Fibroblast Growth Factor 12B; Prev. FGF12B; EIEE47; FHF1; FGF-12; Fibroblast Growth Factor Homologous Factor 1; DEE47; Myocyte-Activating Factor; FHF-1; Fibroblast Growth Factor FGF-12b; FGF; Fibroblast Growth Factor 12; Fibroblast Growth Factor

  • AA Sequence

    MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

  • Predicted Molecular Mass

    20.4 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized FGFR4 at 2 μg/mL (100 μL/well) can bind Biotinylated S FGF-12. The ED50 for this effect is 1.505 µg/mL.

  • FGF-12 Protein, Canine Product Image
    1/16
  • Experimental Validation Results for FGF-12 Protein, Canine
  • Experimental Validation Results for FGF-12 Protein, Canine
  • FGF-12 Protein, Canine Product Image