FGF12 Protein, Canine

FGF12 forms complexes with signaling proteins regulates the cytoskeletal system, binds to FGF receptors, activates signaling cascades to prevent apoptosis and interacts with ribosome biogenetic complexes. FGF12 has been linked to neurological diseases, cancer and heart disease, making it a potential target and therapeutic agent for gene therapy. FGF12 Protein, Canine is the recombinant canine-derived FGF12 protein, expressed by E. coli , with tag free. The total length of FGF12 Protein, Canine is 181 a.a., with molecular weight of ~20 kDa.

FGF family members have a wide range of mitotic and cell survival activities and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. Fibroblast growth factor 12 (FGF12) belongs to the fibroblast growth factor Homologous factor (FHF) subfamily, also known as the FGF11 subfamily. FGF12 is a key player in nervous system development and function, exerting its influence by positively regulating the activity of voltage-gated sodium channels. FGF12 forms complexes with signaling proteins regulates the cytoskeletal system, binds to FGF receptors, activates signaling cascades to prevent apoptosis and interacts with ribosome biogenetic complexes. FGF12 has been linked to neurological diseases, cancer and heart disease, making it a potential target and therapeutic agent for gene therapy^[1][2].

Measured by its binding ability in a functional ELISA. Immobilized FGFR4 at 2 μg/mL (100 μL/well) can bind Biotinylated FGF-12. The ED₅₀ for this effect is 1.505 µg/mL.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Canine

E. coli

Tag Free

A0A5F4CAA4 (M1-T181)

478676  [NCBI]

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Approximately 20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.