1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-18
  6. FGF-18 Protein, Human (HEK293, His)

FGF-18 Protein intricately regulates cell proliferation, differentiation, and migration, crucial in normal ossification and bone development for skeletal maturation. It stimulates hepatic and intestinal proliferation, showcasing versatile functions. Interactions with FGFR3 and FGFR4 underscore FGF-18 Protein's significance in modulating intricate signaling pathways for fundamental tissue development and homeostasis. FGF-18 Protein, Human (HEK293, His) is the recombinant human-derived FGF-18 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-18 Protein intricately regulates cell proliferation, differentiation, and migration, crucial in normal ossification and bone development for skeletal maturation. It stimulates hepatic and intestinal proliferation, showcasing versatile functions. Interactions with FGFR3 and FGFR4 underscore FGF-18 Protein's significance in modulating intricate signaling pathways for fundamental tissue development and homeostasis. FGF-18 Protein, Human (HEK293, His) is the recombinant human-derived FGF-18 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

FGF-18 Protein assumes a pivotal role in intricately regulating cell proliferation, differentiation, and migration. Its indispensability extends to the orchestration of normal ossification and bone development, emphasizing its crucial involvement in skeletal maturation. Additionally, FGF-18 Protein demonstrates the ability to stimulate hepatic and intestinal proliferation, highlighting its versatile functions across different tissues. The mediation of these cellular processes is facilitated through interactions with FGFR3 and FGFR4, underscoring the significance of FGF-18 Protein in modulating intricate signaling pathways that contribute to fundamental processes in tissue development and homeostasis.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized FGF18 Protein, Human (HEK293, His) at 10 μg/mL (100 μl/well) can bind rat FGFR4 and the EC50 is 1.17 μg/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O76093 (E28-A207)

Gene ID
Molecular Construction
N-term
FGF-18 (E28-A207)
Accession # O76093
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Fibroblast growth factor 18; FGF-18; zFGF5; FGF18
AA Sequence

MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA

Molecular Weight

Approximately 32 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-18 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-18 Protein, Human (HEK293, His)
Cat. No.:
HY-P73051
Quantity:
MCE Japan Authorized Agent: