Copy Link Print Information

FGF-18 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

FGF-18 Protein intricately regulates cell proliferation, differentiation, and migration, crucial in normal ossification and bone development for skeletal maturation. It stimulates hepatic and intestinal proliferation, showcasing versatile functions. Interactions with FGFR3 and FGFR4 underscore FGF-18 Protein's significance in modulating intricate signaling pathways for fundamental tissue development and homeostasis. FGF-18 Protein, Human (HEK293, His) is the recombinant human-derived FGF-18 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-18 Protein, Human (HEK293, His)
  • Experimental Validation Results for FGF-18 Protein, Human (HEK293, His)
  • FGF-18 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-18 Protein intricately regulates cell proliferation, differentiation, and migration, crucial in normal ossification and bone development for skeletal maturation. It stimulates hepatic and intestinal proliferation, showcasing versatile functions. Interactions with FGFR3 and FGFR4 underscore FGF-18 Protein's significance in modulating intricate signaling pathways for fundamental tissue development and homeostasis. FGF-18 Protein, Human (HEK293, His) is the recombinant human-derived FGF-18 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

FGF-18 Protein assumes a pivotal role in intricately regulating cell proliferation, differentiation, and migration. Its indispensability extends to the orchestration of normal ossification and bone development, emphasizing its crucial involvement in skeletal maturation. Additionally, FGF-18 Protein demonstrates the ability to stimulate hepatic and intestinal proliferation, highlighting its versatile functions across different tissues. The mediation of these cellular processes is facilitated through interactions with FGFR3 and FGFR4, underscoring the significance of FGF-18 Protein in modulating intricate signaling pathways that contribute to fundamental processes in tissue development and homeostasis.

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA. Immobilized FGF18 Protein, Human (HEK293, His) at 10 μg/mL (100 μl/well) can bind rat FGFR4 and the EC50 is 1.17 μg/mL.
2.Measured by its binding ability in a functional ELISA. Immobilized FGF18 Protein, Human (HEK293, His) at 2 μg/mL (100 μl/well) can bind Human FGFR3 and the EC50 is <2 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized FGF18 Protein, Human (HEK293, His) at 2 μg/mL (100 μl/well) can bind Human FGFR3 and the EC50 is 400.4 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O76093 (E28-A207)

  • Gene ID
    8817  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-18 (E28-A207)
      Accession # O76093
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF18; ZFGF5; Fibroblast Growth Factor 18; Fibroblast Growth Factor; FGF-18; FGF

  • AA Sequence

    EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA

  • Predicted Molecular Mass

    22 kDa

  • Molecular Weight

    Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized FGF18 Protein, Human (HEK293, His) at 2 μg/mL (100 μl/well) can bind Human FGFR3 and the EC50 is 400.4 ng/mL.

  • FGF-18 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for FGF-18 Protein, Human (HEK293, His)
  • Experimental Validation Results for FGF-18 Protein, Human (HEK293, His)
  • FGF-18 Protein, Human (HEK293, His) Product Image