1. Recombinant Proteins
  2. Others
  3. FGG/Fibrinogen gamma chain Protein, Human (P.pastoris)

FGG/Fibrinogen gamma chain Protein, Human (P.pastoris)

Cat. No.: HY-P75772
Handling Instructions Technical Support

FGG/fibrinogen gamma chain proteins polymerize together with FGA and FGB to form the fibrin matrix, which is essential for blood clot formation. In addition to coagulation, it aids in early wound repair, stabilizes lesions, and guides cell migration. FGG/Fibrinogen gamma chain Protein, Human (P.pastoris) is the recombinant human-derived FGG/Fibrinogen gamma chain protein, expressed by P. pastoris , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
20 μg Get quote
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE FGG/Fibrinogen gamma chain Protein, Human (P.pastoris)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGG/fibrinogen gamma chain proteins polymerize together with FGA and FGB to form the fibrin matrix, which is essential for blood clot formation. In addition to coagulation, it aids in early wound repair, stabilizes lesions, and guides cell migration. FGG/Fibrinogen gamma chain Protein, Human (P.pastoris) is the recombinant human-derived FGG/Fibrinogen gamma chain protein, expressed by P. pastoris , with tag free.

Background

Fibrinogen gamma chain (FGG/Fibrinogen gamma chain) protein, in concert with fibrinogen alpha (FGA) and fibrinogen beta (FGB), polymerizes to create the insoluble fibrin matrix, a pivotal component in blood clot formation during hemostasis. Beyond its role in coagulation, this protein contributes to early wound repair by stabilizing lesions and guiding cell migration in re-epithelialization. Initially believed to be essential for platelet aggregation, subsequent studies revealed that it is not absolutely required for thrombus formation in vivo. FGG/Fibrinogen gamma chain enhances the expression of SELP in activated platelets via an ITGB3-dependent pathway. Essential for successful pregnancy, maternal fibrinogen plays a crucial role, and fibrin deposition is associated with infection, providing protection against IFNG-mediated hemorrhage. Furthermore, FGG/Fibrinogen gamma chain may facilitate the antibacterial immune response through both innate and T-cell mediated pathways. Structured as a heterohexamer with two sets of three non-identical chains (alpha, beta, and gamma), the protein's conformation places the N-termini in a small central domain.

Species

Human

Source

P. pastoris

Tag

Tag Free

Accession

P02679-1/NP_068656.2 (V169-L453)

Gene ID
Molecular Construction
N-term
FGG (V169-L453)
Accession # P02679-1/NP_068656.2
C-term
Protein Length

Partial

Synonyms
Fibrinogen gamma chain; FGG; PRO2061
AA Sequence

VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL

Molecular Weight

Approximately 32.2 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

FGG/Fibrinogen gamma chain Protein, Human (P.pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGG/Fibrinogen gamma chain Protein, Human (P.pastoris)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGG/Fibrinogen gamma chain Protein, Human (P.pastoris)
Cat. No.:
HY-P75772
Quantity:
MCE Japan Authorized Agent: