FGG/Fibrinogen gamma chain Protein, Human (P.pastoris)

FGG/fibrinogen gamma chain proteins polymerize together with FGA and FGB to form the fibrin matrix, which is essential for blood clot formation. In addition to coagulation, it aids in early wound repair, stabilizes lesions, and guides cell migration. FGG/Fibrinogen gamma chain Protein, Human (P.pastoris) is the recombinant human-derived FGG/Fibrinogen gamma chain protein, expressed by P. pastoris , with tag free.

Fibrinogen gamma chain (FGG/Fibrinogen gamma chain) protein, in concert with fibrinogen alpha (FGA) and fibrinogen beta (FGB), polymerizes to create the insoluble fibrin matrix, a pivotal component in blood clot formation during hemostasis. Beyond its role in coagulation, this protein contributes to early wound repair by stabilizing lesions and guiding cell migration in re-epithelialization. Initially believed to be essential for platelet aggregation, subsequent studies revealed that it is not absolutely required for thrombus formation in vivo. FGG/Fibrinogen gamma chain enhances the expression of SELP in activated platelets via an ITGB3-dependent pathway. Essential for successful pregnancy, maternal fibrinogen plays a crucial role, and fibrin deposition is associated with infection, providing protection against IFNG-mediated hemorrhage. Furthermore, FGG/Fibrinogen gamma chain may facilitate the antibacterial immune response through both innate and T-cell mediated pathways. Structured as a heterohexamer with two sets of three non-identical chains (alpha, beta, and gamma), the protein's conformation places the N-termini in a small central domain.

Human

P. pastoris

Tag Free

P02679-1/NP_068656.2 (V169-L453)

2266  [NCBI]

Partial

VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL

Approximately 32.2 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.