1. Recombinant Proteins
  2. Immune Checkpoint Proteins Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules
  4. FGL-2
  5. FGL2 Protein, Rat (Biotinylated, HEK293, His-Avi, Flag)

FGL2 Protein, Rat (Biotinylated, HEK293, His-Avi, Flag)

Cat. No.: HY-P700989
Handling Instructions Technical Support

FGL2 is a key enzyme in the coagulation cascade and plays a key role in the conversion of prothrombin to thrombin, reflecting its important contribution to hemostasis and coagulation processes. Structurally, FGL2 forms homotetramers characterized by disulfide bonds that contribute to its functional integrity and catalytic activity in the complex process of thrombin generation. FGL2 Protein, Rat (Biotinylated, HEK293, His-Avi, Flag) is the recombinant rat-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

FGL2 is a key enzyme in the coagulation cascade and plays a key role in the conversion of prothrombin to thrombin, reflecting its important contribution to hemostasis and coagulation processes. Structurally, FGL2 forms homotetramers characterized by disulfide bonds that contribute to its functional integrity and catalytic activity in the complex process of thrombin generation. FGL2 Protein, Rat (Biotinylated, HEK293, His-Avi, Flag) is the recombinant rat-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.

Background

FGL2 (Fibrinogen-Like Protein 2) is a crucial enzyme involved in the coagulation pathway, exerting its function by converting prothrombin into thrombin. This conversion is a pivotal step in the blood clotting process, playing a fundamental role in maintaining hemostasis. Structurally, FGL2 forms a homotetramer, indicating the assembly of four identical subunits. The integrity of this tetrameric structure is maintained through disulfide linkages between the subunits. The homotetrameric arrangement suggests a cooperative mechanism, potentially enhancing the efficiency of FGL2 in its prothrombin-to-thrombin conversion activity. Ongoing research may reveal additional insights into the specific regulatory mechanisms and physiological implications of FGL2 in the coagulation cascade.

Species

Rat

Source

HEK293

Tag

C-Avi;N-His;N-Flag

Accession

Q32Q89 (V193-P427)

Gene ID

/

Protein Length

Partial

Conjugation

Biotin

Synonyms
Fibroleukin; pT49; FGL2; fibrinogen-like 2;
AA Sequence

VQHLIYKDCSDYYVLGKRSSGTYRVTPDHRNSSFEVYCDMETTGGGWTVLQARLDGSTNFTRGWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYAVYDQFYVANEFLKYRLHLGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQRYKGVRNGIFWGTWPGVSQAHPGGYKFSFKKAKMMIRPKSFKP

Predicted Molecular Mass
31.3 kDa
분자량

Approximately 45-55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

FGL2 Protein, Rat (Biotinylated, HEK293, His-Avi, Flag) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

FGL2 Protein, Rat (Biotinylated, HEK293, His-Avi, Flag)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
FGL2 Protein, Rat (Biotinylated, HEK293, His-Avi, Flag)
Cat. No.:
HY-P700989
수량:
MCE Japan Authorized Agent: