1. Recombinant Proteins
  2. CD Antigens Fluorescent-labeled Recombinant Proteins
  3. B Cell CD Proteins
  4. CD37/Tspan-26
  5. FITC-Labeled CD37 Protein, Human (HEK293, Fc)

FITC-Labeled CD37 Protein, Human (HEK293, Fc)

Cat. No.: HY-P701276
Handling Instructions Technical Support

The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. FITC-Labeled CD37 Protein, Human (HEK293, Fc) is the recombinant human-derived FITC-Labeled CD37 protein, expressed by HEK293 , with Fc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. FITC-Labeled CD37 Protein, Human (HEK293, Fc) is the recombinant human-derived FITC-Labeled CD37 protein, expressed by HEK293 , with Fc labeled tag.

Background

CD37 protein is known to interact with SCIMP, indicating a functional association between these two molecules. CD37 is a transmembrane protein that belongs to the tetraspanin family and is primarily expressed on the surface of B cells and other immune cells. It plays a role in various cellular processes, including signal transduction, adhesion, and immune modulation. The interaction with SCIMP suggests a potential involvement of CD37 in immune signaling pathways or protein complex formation, but further investigation is necessary to fully elucidate the functional significance of this interaction.

Species

Human

Source

HEK293

Tag

Fc

Accession

P11049 (R112-N241)

Gene ID

951

Protein Length

Extracellular Domain

Synonyms
CD37; Tspan-26; TSPAN26
AA Sequence

RAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN

Predicted Molecular Mass
41.3 kDa
Molecular Weight

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FITC-Labeled CD37 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FITC-Labeled CD37 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FITC-Labeled CD37 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P701276
Quantity:
MCE Japan Authorized Agent: