FKBP3 Protein, Human (His)
Based on 1 Customer Validation
FKBP3 is a member of the FK506 and rapamycin-binding protein (FKBP) family and serves as a receptor for the immunosuppressants FK506 and rapamycin, both of which inhibit two distinct cytoplasmic signaling pathways. T cell proliferation. In addition to serving as a receptor for these immunosuppressants, FKBP3, like other peptidyl prolyl cis-trans isomerases (PPIases), also functions to accelerate protein folding. FKBP3 Protein, Human (His) is the recombinant human-derived FKBP3 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
FKBP3 is a member of the FK506 and rapamycin-binding protein (FKBP) family and serves as a receptor for the immunosuppressants FK506 and rapamycin, both of which inhibit two distinct cytoplasmic signaling pathways. T cell proliferation. In addition to serving as a receptor for these immunosuppressants, FKBP3, like other peptidyl prolyl cis-trans isomerases (PPIases), also functions to accelerate protein folding. FKBP3 Protein, Human (His) is the recombinant human-derived FKBP3 protein, expressed by E. coli , with N-6*His labeled tag.
Background
FKBP3, also known as FK506-binding protein 3, is a member of the FK506- and rapamycin-binding protein (FKBP) family, which acts as receptors for the immunosuppressants FK506 and rapamycin. These proteins play a crucial role in inhibiting T-cell proliferation by disrupting two distinct cytoplasmic signal transmission pathways. FKBP3, like other members of the family, possesses peptidyl-prolyl isomerase (PPIase) activity, which accelerates the folding of proteins. The PPIase function of FKBP3 is significant in facilitating the proper conformation and maturation of proteins, emphasizing its role beyond immunosuppression in cellular processes related to protein folding.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q00688 (M1-D224)
-
Molecular Construction
-
N-term
-
6*His
-
FKBP3 (M1-D224)
Accession # Q00688 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FKBP3; PPIase FKBP3; FKBP Prolyl Isomerase 3; 25 KDa FKBP; FKBP-25; Rotamase; FKBP25; FKBP-3; Peptidyl-Prolyl Cis-Trans Isomerase FKBP3; FK506-Binding Protein 25, T-Cell; Rapamycin-Selective 25 KDa Immunophilin; FK506-Binding Protein 3 (25kD); FK506 Bindi
-
AA Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
-
Predicted Molecular Mass
27.3 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, 10% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)