FLRT1 Protein, Human (504a.a, HEK293, His)

FLRT1 is a key player in FGF-mediated signaling, activating MAP kinase and enhancing neurite outgrowth through FGFR1-mediated signaling. It helps increase the number and length of neurites. FLRT1 Protein, Human (504a.a, HEK293, His) is the recombinant human-derived FLRT1 protein, expressed by HEK293 , with C-His labeled tag. The total length of FLRT1 Protein, Human (504a.a, HEK293, His) is 504 a.a., with molecular weight of 60-85 kDa.

FLRT1 emerges as a key participant in fibroblast growth factor (FGF)-mediated signaling pathways, orchestrating the activation of MAP kinases. In the context of neurite outgrowth, FLRT1 plays a pivotal role by facilitating FGFR1-mediated activation of downstream MAP kinases, leading to a significant increase in both neurite number and length. Beyond its involvement in neural processes, FLRT1 is implicated in cell-cell adhesion and cell guidance through its interactions with ADGRL1/LPHN1 and ADGRL3. These interactions, particularly with FGFR1, ADGRL1/LPHN1, and ADGRL3, underscore FLRT1's versatility and its contribution to diverse cellular functions, ranging from neural development to cell adhesion and guidance.

Immobilized Human FLRT1, His Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-FLRT1 Antibody, mFc Tag with the EC₅₀ of 3.5 ng/mL determined by ELISA.

Human

HEK293

C-His

Q9NZU1 (I21-P524)

23769  [NCBI]

IDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLP

60-85 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.