FLRT1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
FLRT1 is a key player in FGF-mediated signaling, activating MAP kinase and enhancing neurite outgrowth through FGFR1-mediated signaling.It helps increase the number and length of neurites. FLRT1 Protein, Human (HEK293, His) is the recombinant human-derived FLRT1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FLRT1 is a key player in FGF-mediated signaling, activating MAP kinase and enhancing neurite outgrowth through FGFR1-mediated signaling.It helps increase the number and length of neurites. FLRT1 Protein, Human (HEK293, His) is the recombinant human-derived FLRT1 protein, expressed by HEK293 , with C-His labeled tag.
Background
FLRT1 emerges as a key participant in fibroblast growth factor (FGF)-mediated signaling pathways, orchestrating the activation of MAP kinases. In the context of neurite outgrowth, FLRT1 plays a pivotal role by facilitating FGFR1-mediated activation of downstream MAP kinases, leading to a significant increase in both neurite number and length. Beyond its involvement in neural processes, FLRT1 is implicated in cell-cell adhesion and cell guidance through its interactions with ADGRL1/LPHN1 and ADGRL3. These interactions, particularly with FGFR1, ADGRL1/LPHN1, and ADGRL3, underscore FLRT1's versatility and its contribution to diverse cellular functions, ranging from neural development to cell adhesion and guidance.
Verified Bioactivity
Immobilized Human FLRT1, His Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-FLRT1 Antibody, mFc Tag with the EC50 of 3.5 ng/mL determined by ELISA.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q9NZU1-1 (I21-P524)
-
Molecular Construction
-
N-term
-
FLRT1 (I21-P524)
Accession # Q9NZU1-1 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
FLRT1; Fibronectin-Like Domain-Containing Leucine-Rich Transmembrane Protein 1; Fibronectin Leucine Rich Transmembrane Protein 1; Leucine-Rich Repeat Transmembrane Protein FLRT1; SPG68; MGC21624
-
AA Sequence
IDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLP
-
Molecular Weight
Approximately 60-85 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
