1. Recombinant Proteins
  2. CAR-T Related Proteins Receptor Proteins Biotinylated Proteins
  3. Folate Receptor alpha (FR-alpha)
  4. FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi)

FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78871
Instrucciones de manejo Technical Support

FOLR1 Protein, binding to folate and reduced folic acid derivatives, facilitates their delivery into cells. It maintains high affinity under neutral pH but undergoes a conformational change upon endocytosis, reducing affinity and releasing folates in slightly acidic pH. Crucial for embryonic development, cell proliferation, and renal folate reabsorption. FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived FOLR1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi) is 208 a.a., with molecular weight of 32-45 kDa.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
25 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Obtener un presupuesto  
Synthetic products have potential research and development risk.

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

FOLR1 Protein, binding to folate and reduced folic acid derivatives, facilitates their delivery into cells. It maintains high affinity under neutral pH but undergoes a conformational change upon endocytosis, reducing affinity and releasing folates in slightly acidic pH. Crucial for embryonic development, cell proliferation, and renal folate reabsorption. FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived FOLR1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi) is 208 a.a., with molecular weight of 32-45 kDa.

Background

The FOLR1 protein binds to folate and reduced folic acid derivatives, facilitating the delivery of 5-methyltetrahydrofolate and folate analogs into cells. It exhibits a high affinity for folate and folic acid analogs under neutral pH conditions. Upon endocytosis and exposure to slightly acidic pH, a conformational change occurs, leading to a significant reduction in its affinity for folates and subsequent release. This protein is essential for normal embryonic development, cell proliferation, and renal folate reabsorption.

Actividad biológica

Immobilized Folic acid-BSA at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse FOLR1 His-Avi with a linear range of 0.008-0.222 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-His

Accession

P35846 (T25-S232)

Gene ID
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
FOLR-1; FBP; FOLR
AA Sequence

TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMS

Peso molecular

32-45 kDa

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78871
Cantidad:
MCE Japan Authorized Agent: