FOLR1 Protein, Rat (HEK293, Fc)

The FOLR1 protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind folate (vitamin B9) and transport it into cells. FOLR1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived FOLR1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of FOLR1 Protein, Rat (HEK293, Fc) is 212 a.a., with molecular weight of ~50.9 kDa.

FOLR1 Protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind and transport folate (vitamin B9) into cells. FOLR1 is widely expressed in various tissues, including the placenta, kidney, lung, and intestine. It plays a crucial role in folate metabolism by mediating the cellular uptake of folate. FOLR1 is particularly important during pregnancy, as it facilitates the transport of folate across the placenta to support fetal development. In addition to its role in folate transport, FOLR1 has been implicated in other cellular processes, including cell adhesion, migration, and signaling. It is also being investigated as a potential target for cancer therapy, as FOLR1 expression is frequently upregulated in several types of cancer cells, making it a promising candidate for targeted drug delivery.

Rat

HEK293

C-hFc

G3V8M6/NP_598211.1 (A20-M231)

171049  [NCBI]

AQSRATRARTELLNVCMDAKHHKEKPGPEDKLHDQCSPWKTNACCSTNTSQEDTKDISYLYRFNWNHCGTMTPECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCVLWWEDCKSSFTCKSNWLKGWNWTSGHNECPVGASCHPFTFYFPTPAVLCEKIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEVM

Approximately 50.9 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.