1. Recombinant Proteins
  2. CAR-T Related Proteins Receptor Proteins
  3. Folate Receptor alpha (FR-alpha)
  4. FOLR1 Protein, Rat (HEK293, Fc)

The FOLR1 protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind folate (vitamin B9) and transport it into cells. FOLR1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived FOLR1 protein, expressed by HEK293 , with C-hFc labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The FOLR1 protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind folate (vitamin B9) and transport it into cells. FOLR1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived FOLR1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

FOLR1 Protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind and transport folate (vitamin B9) into cells. FOLR1 is widely expressed in various tissues, including the placenta, kidney, lung, and intestine. It plays a crucial role in folate metabolism by mediating the cellular uptake of folate. FOLR1 is particularly important during pregnancy, as it facilitates the transport of folate across the placenta to support fetal development. In addition to its role in folate transport, FOLR1 has been implicated in other cellular processes, including cell adhesion, migration, and signaling. It is also being investigated as a potential target for cancer therapy, as FOLR1 expression is frequently upregulated in several types of cancer cells, making it a promising candidate for targeted drug delivery.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

NP_598211.1 (A20-M231)

Gene ID
Molecular Construction
N-term
FOLR1 (A20-M231)
Accession # NP_598211.1
hFc
C-term
Protein Length

Partial

Synonyms
Folate receptor alpha; FR-alpha; FBP; FOLR1; FOLR
AA Sequence

AQSRATRARTELLNVCMDAKHHKEKPGPEDKLHDQCSPWKTNACCSTNTSQEDTKDISYLYRFNWNHCGTMTPECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCVLWWEDCKSSFTCKSNWLKGWNWTSGHNECPVGASCHPFTFYFPTPAVLCEKIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEVM

Peso molecular

Approximately 50.9 kDa

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

FOLR1 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

FOLR1 Protein, Rat (HEK293, Fc)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
FOLR1 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P75775
Cantidad:
MCE Japan Authorized Agent: