Copy Link Print Information

FOXM1 Protein, Human (His, SUMO-Myc)

Customer Review

Based on 1 Customer Validation

FOXM1 is an important transcription factor that controls cell cycle gene expression critical for DNA replication and mitosis, underscoring its critical role in cellular processes. In addition to cell proliferation, FOXM1 contributes to DNA break repair and DNA damage checkpoint responses. FOXM1 Protein, Human (His, SUMO-Myc) is the recombinant human-derived FOXM1 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • FOXM1 Protein, Human (His, SUMO-Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FOXM1 is an important transcription factor that controls cell cycle gene expression critical for DNA replication and mitosis, underscoring its critical role in cellular processes. In addition to cell proliferation, FOXM1 contributes to DNA break repair and DNA damage checkpoint responses. FOXM1 Protein, Human (His, SUMO-Myc) is the recombinant human-derived FOXM1 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag.

Background

FOXM1, a crucial transcription factor, governs the expression of cell cycle genes vital for DNA replication and mitosis, underscoring its pivotal role in orchestrating cellular processes. Beyond its involvement in cell proliferation control, FOXM1 also contributes to DNA break repair, actively participating in the DNA damage checkpoint response. Notably, FOXM1 promotes the transcription of PHB2, emphasizing its diverse regulatory functions. Furthermore, FOXM1 interacts with PINT87aa, a product encoded by the circular form of the long non-coding RNA LINC-PINT, and this interaction serves to inhibit FOXM1-mediated transcription of PHB2, revealing an intricate layer of regulatory control in cellular transcriptional processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His;C-Myc;N-SUMO
  • Accession

    Q08050-1 (E235-L327)

  • Gene ID
    2305  [NCBI]
  • Molecular Construction
    • N-term
    • 10*His
    • FOXM1 (E235-L327)
      Accession # Q08050-1
    • Myc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FOXM1; Forkhead-Related Protein FKHL16; Prev. FKHL16; HNF-3/Fork-Head Homolog 11; HFH-11; HFH11; MPP2; TGT3; M-Phase Phosphoprotein 2; Forkhead, Drosophila, Homolog-Like 16; Forkhead Box Protein M1; Forkhead Box M1-D; MPHOSPH2; FOXM1A; Trident; FOXM1B; HN

  • AA Sequence

    ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL

  • Predicted Molecular Mass

    31.2 kDa

  • Molecular Weight

    Approximately 31 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FOXM1 Protein, Human (His, SUMO-Myc) Product Image
    1/16
  • FOXM1 Protein, Human (His, SUMO-Myc) Product Image