FOXM1 Protein, Human (His, SUMO-Myc)

FOXM1 is an important transcription factor that controls cell cycle gene expression critical for DNA replication and mitosis, underscoring its critical role in cellular processes. In addition to cell proliferation, FOXM1 contributes to DNA break repair and DNA damage checkpoint responses. FOXM1 Protein, Human (His, SUMO-Myc) is the recombinant human-derived FOXM1 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag. The total length of FOXM1 Protein, Human (His, SUMO-Myc) is 93 a.a., with molecular weight of ~31.2 kDa.

FOXM1, a crucial transcription factor, governs the expression of cell cycle genes vital for DNA replication and mitosis, underscoring its pivotal role in orchestrating cellular processes. Beyond its involvement in cell proliferation control, FOXM1 also contributes to DNA break repair, actively participating in the DNA damage checkpoint response. Notably, FOXM1 promotes the transcription of PHB2, emphasizing its diverse regulatory functions. Furthermore, FOXM1 interacts with PINT87aa, a product encoded by the circular form of the long non-coding RNA LINC-PINT, and this interaction serves to inhibit FOXM1-mediated transcription of PHB2, revealing an intricate layer of regulatory control in cellular transcriptional processes.

Human

E. coli

N-10*His;C-Myc;N-SUMO

Q08050 (E235-L327)

2305  [NCBI]

ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL

Approximately 31.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.