1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CX3CL1
  5. Fractalkine/CX3CL1 Protein, Cynomolgus (HEK293, Fc)

Fractalkine/CX3CL1 Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P76938
Handling Instructions Technical Support

Fractalkine/CX3CL1 protein, a chemokine, binds CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. It regulates immune response, inflammation, adhesion, chemotaxis, and leukocyte migration. It activates integrins via CX3CR1-dependent and -independent pathways, binding to site 1 with CX3CR1 and site 2 without CX3CR1. Soluble Fractalkine/CX3CL1 attracts T-cells and monocytes, not neutrophils. Fractalkine/CX3CL1 Protein, Cynomolgus (HEK293, Fc) is the recombinant Cynomolgus-derived Fractalkine/CX3CL1 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Fractalkine/CX3CL1 protein, a chemokine, binds CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. It regulates immune response, inflammation, adhesion, chemotaxis, and leukocyte migration. It activates integrins via CX3CR1-dependent and -independent pathways, binding to site 1 with CX3CR1 and site 2 without CX3CR1. Soluble Fractalkine/CX3CL1 attracts T-cells and monocytes, not neutrophils. Fractalkine/CX3CL1 Protein, Cynomolgus (HEK293, Fc) is the recombinant Cynomolgus-derived Fractalkine/CX3CL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Fractalkine/CX3CL1 is a chemokine that serves as a ligand for both CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. Its signaling through the CX3CR1-CX3CL1 pathway plays various roles in different tissue compartments, including immune response, inflammation, cell adhesion, and chemotaxis. It regulates leukocyte adhesion and migration at the endothelium and can activate integrins in both a CX3CR1-dependent and CX3CR1-independent manner. In the presence of CX3CR1, it activates integrins by binding to the classical ligand-binding site (site 1), while in the absence of CX3CR1, it binds to a second site (site 2) in integrins that is distinct from site 1 and enhances the binding of other integrin ligands to site 1. The soluble form of Fractalkine/CX3CL1 acts as a chemotactic factor for T-cells and monocytes but not neutrophils.

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

EHH60415.1 (Q25-G100)

Gene ID

/

Molecular Construction
N-term
Fractalkine (Q25-G100)
Accession # EHH60415.1
hFc
C-term
Protein Length

Full Length of Chemokine_CX3C

Synonyms
Fractalkine; C-X3-C motif chemokine 1; Neurotactin; CX3CL1; FKN; NTT; SCYD1
AA Sequence

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQESCGKRAIVLETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

분자량

Approximately 40.8&35.2 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

Fractalkine/CX3CL1 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Fractalkine/CX3CL1 Protein, Cynomolgus (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Fractalkine/CX3CL1 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P76938
수량:
MCE Japan Authorized Agent: