1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled-10/CD350 Frizzled
  5. Frizzled-10/CD350 Protein, Mouse (HEK293, Fc)

Frizzled-10/CD350 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P74145
Handling Instructions Technical Support

Frizzled-10/CD350 protein is a receptor for Wnt proteins that functions in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target gene activation. Secondary signaling pathways involve PKC and calcium flux. Frizzled-10/CD350 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Frizzled-10/CD350 protein is a receptor for Wnt proteins that functions in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target gene activation. Secondary signaling pathways involve PKC and calcium flux. Frizzled-10/CD350 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Frizzled-10/CD350 Protein operates as a receptor for Wnt proteins, functioning primarily in the canonical Wnt/beta-catenin signaling pathway. This pathway orchestrates the activation of disheveled proteins, inhibits GSK-3 kinase, facilitates nuclear accumulation of beta-catenin, and triggers the activation of Wnt target genes. Alongside the canonical pathway, a secondary signaling route involving PKC and calcium fluxes has been identified for some family members. The interplay between these pathways and their potential integration remains to be fully elucidated, given PKC's apparent role in Wnt-mediated inactivation of GSK-3 kinase. Frizzled-10 may play a crucial role in transducing and transmitting polarity information during tissue morphogenesis or within differentiated tissues. Interactions with MYOC and WNT7B underscore its involvement in intricate cellular processes and signal transduction cascades.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q8BKG4 (I22-G162)

Gene ID
Molecular Construction
N-term
CD350 (I22-G162)
Accession # Q8BKG4
hFc
C-term
Protein Length

Partial

Synonyms
CD350 antigen; CD350; Frizzled-10; FZ-10; FZD10
AA Sequence

ISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRG

Predicted Molecular Mass
43 kDa
Molecular Weight

Approximately 52 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Frizzled-10/CD350 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-10/CD350 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P74145
Quantity:
MCE Japan Authorized Agent: