Frizzled-6 Protein, Human (HEK293, Fc)

Frizzled-6 is a Wnt receptor that complexly activates signaling pathways that converge primarily on the β-catenin canonical pathway. This triggers disorganized protein activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-6 Protein, Human (HEK293, Fc) is the recombinant human-derived Frizzled-6 protein, expressed by HEK293 , with C-mFc labeled tag.

Frizzled-6, a receptor for Wnt proteins, is intricately involved in signaling pathways that predominantly converge on the beta-catenin canonical pathway. This cascade triggers the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. While a secondary signaling pathway implicating PKC and calcium fluxes has been observed in some family members, its precise relationship with the canonical pathway remains unclear, and the requirement of PKC for Wnt-mediated inactivation of GSK-3 kinase adds complexity to this interplay. Interactions with G-proteins are integral to both pathways. Frizzled-6 is positioned to play a pivotal role in transducing polarity information during tissue morphogenesis and in differentiated tissues. Teaming up with FZD3, it contributes to neural tube closure and regulates the establishment of planar cell polarity, especially in orienting asymmetric bundles of stereocilia on the apical faces of select auditory and vestibular sensory cells within the inner ear. Its functional repertoire is further underscored by interactions with LMBR1L.

Human

HEK293

C-mFc

O60353-1 (H19-V153)

8323  [NCBI]

Partial

HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQV

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.