Galanin Protein, Human (N-His, C-Myc)

Galanin exists as an endocrine hormone in the central and peripheral nervous systems and exerts its effects by binding to and activating G protein-coupled receptors (i.e., GALR1, GALR2, and GALR3). Galanin Protein, Human (N-His, C-Myc) is the recombinant human-derived Galanin protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Galanin is a neuropeptide acting as an endocrine hormone in both the central and peripheral nervous systems, engaging G protein-coupled receptors, specifically GALR1, GALR2, and GALR3. This small protein exerts regulatory control over a range of physiological functions, including the contraction of smooth muscles in the gastrointestinal and genitourinary tract, as well as the modulation of growth hormone and insulin release, and adrenal secretion. By binding to its specific receptors, galanin plays a multifaceted role in coordinating various physiological processes, highlighting its significance in the intricate network of signaling pathways within the body. (

Human

E. coli

C-Myc;N-10*His

P22466 (G44-S123)

51083  [NCBI]

Partial

GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.