Galectin-3/LGALS3 Protein, Human (HEK293, His)

The Galectin-3/LGALS3 protein is a galactose-specific lectin known for its diverse roles in cellular processes. It binds IgE and synergizes with α-3 and β-1 integrins to promote CSPG4-induced endothelial cell migration. Galectin-3/LGALS3 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Galectin-3/LGALS3 Protein, Human (HEK293, His) is 249 a.a., with molecular weight of 33-36 kDa.

The Galectin-3/LGALS3 Protein is a galactose-specific lectin known for its versatile roles in cellular processes. It binds IgE and, in collaboration with the alpha-3, beta-1 integrin, facilitates CSPG4-induced migration of endothelial cells. Together with DMBT1, it is crucial for the terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus, the protein serves as a pre-mRNA splicing factor and is actively involved in acute inflammatory responses, influencing neutrophil activation, adhesion, chemoattraction of monocytes and macrophages, opsonization of apoptotic neutrophils, and mast cell activation. Its partnership with TRIM16 allows for the coordinated recognition of membrane damage, triggering the mobilization of core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. The protein likely forms homo- or heterodimers and engages with various partners, including DMBT1, CD6, ALCAM, ITGA3, ITGB1, CSPG4, LGALS3BP, LYPD3, ZFTRAF1, UACA, TRIM16, and TMED10, facilitating diverse cellular interactions, including autophagy and secretion.

Measured by the ability of the immobilized protein to support the adhesion of TF-1 Human blood leukemia cells. The ED₅₀ this effect is 6.301 μg/ml, corresponding to a specific activity is 158.705 units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of TF-1 Human blood leukemia cells. The ED₅₀ for this effect is 6.301 μg/ml, corresponding to a specific activity is 158.705 units/mg.

Human

HEK293

C-6*His

AAH53667.1 (A2-I250)

3958  [NCBI]

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

33-36 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 3 mM DTT, pH 7.4 or 20 mM PB, 150 mM NaCl, 3 mM DTT, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.