GALNT2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The GALNT2 protein catalyzes the initial steps in O-linked oligosaccharide biosynthesis by transferring N-acetyl-D-galactosamine to a protein receptor. GALNT2 Protein, Human (HEK293, His) is the recombinant human-derived GALNT2 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The GALNT2 protein catalyzes the initial steps in O-linked oligosaccharide biosynthesis by transferring N-acetyl-D-galactosamine to a protein receptor. GALNT2 Protein, Human (HEK293, His) is the recombinant human-derived GALNT2 protein, expressed by HEK293 , with N-His labeled tag.

Background

GALNT2 protein serves as a key enzyme in O-linked oligosaccharide biosynthesis, initiating the process by transferring an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. This enzymatic activity exhibits a wide substrate spectrum, including peptides such as EA2, Muc5AC, Muc1a, and Muc1b. GALNT2 is implicated in the O-linked glycosylation of critical proteins, including the immunoglobulin A1 (IgA1) hinge region, APOC-III, ANGPTL3, and PLTP. Additionally, it plays a role in the regulation of high-density lipoprotein cholesterol (HDL-C) metabolism, contributing to the intricate processes governing lipid homeostasis.

Verified Bioactivity

Measured by its ability to transfer GalNAc from UDP-GalNAc to EA2 that incubate at 37°C for 20 min. The specific activity is 379.51-404.75 pmol/min/μg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • GALNT2 (K52-Q571)
      Accession # Q10471/NP_004472.1
    • C-term
  • Protein Length

    Full Length of GALNT2, soluble form

  • Synonyms

    GALNT2; Pp-GaNTase 2; Polypeptide N-Acetylgalactosaminyltransferase 2; Protein-UDP Acetylgalactosaminyltransferase 2; GalNAc-T2; Polypeptide N-Acetylgalactosaminyltransferase; Polypeptide GalNAc Transferase 2; Protein-UDP Acetylgalactosaminyltransferase;

  • AA Sequence

    KKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ

  • Molecular Weight

    Approximately 57-65 kDa & 46 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 25 mM Tris-HCl, 150 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of 25 mM Tris-HCl, 150 mM NaCl, pH 7.5, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00