1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GALNT2 Protein, Human (HEK293, His)

GALNT2 Protein, Human (HEK293, His)

Cat. No.: HY-P76355
SDS COA Handling Instructions

The GALNT2 protein catalyzes the initial steps in O-linked oligosaccharide biosynthesis by transferring N-acetyl-D-galactosamine to a protein receptor. GALNT2 Protein, Human (HEK293, His) is the recombinant human-derived GALNT2 protein, expressed by HEK293 , with N-His labeled tag. The total length of GALNT2 Protein, Human (HEK293, His) is 520 a.a., with molecular weight of 63 KDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GALNT2 protein catalyzes the initial steps in O-linked oligosaccharide biosynthesis by transferring N-acetyl-D-galactosamine to a protein receptor. GALNT2 Protein, Human (HEK293, His) is the recombinant human-derived GALNT2 protein, expressed by HEK293 , with N-His labeled tag. The total length of GALNT2 Protein, Human (HEK293, His) is 520 a.a., with molecular weight of 63 KDa, respectively.

Background

GALNT2 protein serves as a key enzyme in O-linked oligosaccharide biosynthesis, initiating the process by transferring an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. This enzymatic activity exhibits a wide substrate spectrum, including peptides such as EA2, Muc5AC, Muc1a, and Muc1b. GALNT2 is implicated in the O-linked glycosylation of critical proteins, including the immunoglobulin A1 (IgA1) hinge region, APOC-III, ANGPTL3, and PLTP. Additionally, it plays a role in the regulation of high-density lipoprotein cholesterol (HDL-C) metabolism, contributing to the intricate processes governing lipid homeostasis.

Biological Activity

Measured by its ability to transfer GalNAc from UDP-GalNAc to EA2 that incubate at 37°C for 20 min. The specific activity is 379.51-404.75 pmol/min/μg.

Species

Human

Source

HEK293

Tag

N-10*His

Accession

Q10471-1/NP_004472.1 (K52-Q571)

Gene ID
Molecular Construction
N-term
His
GALNT2 (K52-Q571)
Accession # Q10471/NP_004472.1
C-term
Synonyms
Polypeptide N-acetylgalactosaminyltransferase 2; GalNAc-T2
AA Sequence

KKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ

Molecular Weight

Approximately 63 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 25 mM Tris, 150 mM NaCl, pH 7.5 or 25 mM Tris-HCL, 150 mM NaCl, pH 7.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GALNT2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GALNT2 Protein, Human (HEK293, His)
Cat. No.:
HY-P76355
Quantity:
MCE Japan Authorized Agent: