1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. TGF-beta Superfamily Neurotrophic Factors
  4. Transforming Growth Factor-β TGF- β
  5. TGF-β1
  6. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi)

GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P77675
COA Handling Instructions

LRRC32, a key regulator of TGF-beta activation, maintains TGFB1, TGFB2, and TGFB3 in a latent state during extracellular storage by binding to Latency-associated peptide (LAP). Competing with LTBP1 for LAP binding, LRRC32 effectively modulates integrin-dependent TGF-beta activation. Its significance spans the regulation of TGF-beta-1 (TGFB1) on activated Tregs' surface and the control of TGF-beta-3 (TGFB3) during palate development, emphasizing LRRC32's intricate role in fine-tuning TGF-beta signaling. Interactions with TGFB1, TGFB2, TGFB3, and LAPTM4B contribute to its regulatory functions. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant protein dimer complex containing human-derived GARP&Latent TGF beta Complex protein, expressed by HEK293, with C-Avi, C-His labeled tag. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi), has molecular weight of (73-78) kDa (GARP) & 13 kDa & (42-45) kDa (Latent TGF beta 1), respectively.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $265 In-stock
50 μg $580 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LRRC32, a key regulator of TGF-beta activation, maintains TGFB1, TGFB2, and TGFB3 in a latent state during extracellular storage by binding to Latency-associated peptide (LAP). Competing with LTBP1 for LAP binding, LRRC32 effectively modulates integrin-dependent TGF-beta activation. Its significance spans the regulation of TGF-beta-1 (TGFB1) on activated Tregs' surface and the control of TGF-beta-3 (TGFB3) during palate development, emphasizing LRRC32's intricate role in fine-tuning TGF-beta signaling. Interactions with TGFB1, TGFB2, TGFB3, and LAPTM4B contribute to its regulatory functions. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant protein dimer complex containing human-derived GARP&Latent TGF beta Complex protein, expressed by HEK293, with C-Avi, C-His labeled tag. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi), has molecular weight of (73-78) kDa (GARP) & 13 kDa & (42-45) kDa (Latent TGF beta 1), respectively.

Background

LRRC32, a crucial regulator of transforming growth factor beta (TGFB1, TGFB2, and TGFB3), plays a pivotal role in controlling TGF-beta activation by maintaining it in a latent state during extracellular storage. Specifically associating with the Latency-associated peptide (LAP), the regulatory chain of TGF-beta, LRRC32 exerts its regulatory influence on integrin-dependent TGF-beta activation. Notably, LRRC32 competes effectively with LTBP1 for LAP binding, further modulating TGF-beta activation. Its significance extends to the regulation of TGF-beta-1 (TGFB1) activation on the surface of activated regulatory T-cells (Tregs). Moreover, LRRC32's involvement is essential for epithelial fusion during palate development, where it regulates the activation of TGF-beta-3 (TGFB3). Interacting directly with TGFB1, TGFB2, and TGFB3, LRRC32's association with LAP regulates the activation of TGF-beta-1 and TGF-beta-3, highlighting its intricate role in fine-tuning TGF-beta signaling. Additionally, LRRC32 interacts with LAPTM4B, contributing to the reduction of TGFB1 production in regulatory T-cells.

Biological Activity

Immobilized Biotinylated Human GARP&Latent TGF beta Complex at 5 μg/mL (100μL/Well) on the plate. Dose response curve for Anti-GARP&TGF beta Antibody with the EC50 of 44-45.8 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

Q14392 (H20-L628,GARP)&P01137 (L30-S390,Latent TGF bata 1)

Gene ID

2615  [NCBI]&7040  [NCBI]

Synonyms
LRRC32; GARP; LAP; TGF-beta-1; LRRC32&TGF-beta 1; LRRC32&TGFB1
AA Sequence

HQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINL&LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Weight

(73-78) kDa (GARP)&13 kDa&(42-45) kDa (Latent TGF beta 1)

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P77675
Quantity:
MCE Japan Authorized Agent: