Copy Link Print Information

GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

LRRC32 is a key regulator of TGF-β activation and maintains TGFB1, TGFB2, and TGFB3 in the latent state during extracellular storage by binding to latency-associated peptide (LAP). LRRC32 competes with LTBP1 for LAP binding and effectively regulates integrin-dependent TGF-β activation. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant protein dimer complex containing human-derived GARP&Latent TGF beta Complex protein, expressed by HEK293 , with C-Avi, C-His labeled tag. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi), has molecular weight of (73-78) kDa (GARP) & 13 kDa & (42-45) kDa (Latent TGF beta 1), respectively.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

LRRC32 is a key regulator of TGF-β activation and maintains TGFB1, TGFB2, and TGFB3 in the latent state during extracellular storage by binding to latency-associated peptide (LAP). LRRC32 competes with LTBP1 for LAP binding and effectively regulates integrin-dependent TGF-β activation. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant protein dimer complex containing human-derived GARP&Latent TGF beta Complex protein, expressed by HEK293 , with C-Avi, C-His labeled tag. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi), has molecular weight of (73-78) kDa (GARP) & 13 kDa & (42-45) kDa (Latent TGF beta 1), respectively.

Background

LRRC32, a crucial regulator of transforming growth factor beta (TGFB1, TGFB2, and TGFB3), plays a pivotal role in controlling TGF-beta activation by maintaining it in a latent state during extracellular storage. Specifically associating with the Latency-associated peptide (LAP), the regulatory chain of TGF-beta, LRRC32 exerts its regulatory influence on integrin-dependent TGF-beta activation. Notably, LRRC32 competes effectively with LTBP1 for LAP binding, further modulating TGF-beta activation. Its significance extends to the regulation of TGF-beta-1 (TGFB1) activation on the surface of activated regulatory T-cells (Tregs). Moreover, LRRC32's involvement is essential for epithelial fusion during palate development, where it regulates the activation of TGF-beta-3 (TGFB3). Interacting directly with TGFB1, TGFB2, and TGFB3, LRRC32's association with LAP regulates the activation of TGF-beta-1 and TGF-beta-3, highlighting its intricate role in fine-tuning TGF-beta signaling. Additionally, LRRC32 interacts with LAPTM4B, contributing to the reduction of TGFB1 production in regulatory T-cells.

Verified Bioactivity

1. Immobilized Biotinylated Human GARP&Latent TGF beta Complex at 5 μg/mL (100μL/Well) on the plate. Dose response curve for Anti-GARP&TGF beta Antibody with the EC50 of 44-45.8 ng/mL determined by ELISA.
2. Immobilized Anti-GARP&TGF beta 1 Antibody at 5μg/ml(100μl/well) on the plate. Dose response curve for Human GARP&Latent TGF Beta 1 Complex, His Tag with the EC50 of 45.8ng/ml determined by ELISA.
3. Immobilized Human ITGAV&ITGB6, His Tag at 5μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human GARP&Latent TGF Beta 1 Complex, His Avi Tag with the EC50 of 91.0ng/ml determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession

    Q14392 (H20-L628,GARP)&P01137 (L30-S390,Latent TGF bata 1)

  • Gene ID
    2615  [NCBI]&7040  [NCBI]
  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    LRRC32; Transforming Growth Factor Beta Activator LRRC32; Prev. D11S833E; Garpin; Prev. GARP; CPPRDD; Glycoprotein A Repetitions Predominant; Leucine Rich Repeat Containing 32; Leucine-Rich Repeat-Containing Protein 32; TGFB1; Transforming Growth Factor B

  • AA Sequence

    HQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINL&LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

  • Predicted Molecular Mass

    70.3 kDa (GARP) & 41.4 kDa (Latent TGF beta 1)

  • Molecular Weight

    Approximately 73-78 kDa (GARP) & 13 kDa & 42-45 kDa (Latent TGF beta 1), based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
    1/16
  • GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) Product Image