GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi)

LRRC32 is a key regulator of TGF-β activation and maintains TGFB1, TGFB2, and TGFB3 in the latent state during extracellular storage by binding to latency-associated peptide (LAP). LRRC32 competes with LTBP1 for LAP binding and effectively regulates integrin-dependent TGF-β activation. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant protein dimer complex containing human-derived GARP&Latent TGF beta Complex protein, expressed by HEK293 , with C-Avi, C-His labeled tag. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi), has molecular weight of (73-78) kDa (GARP) & 13 kDa & (42-45) kDa (Latent TGF beta 1), respectively.

LRRC32, a crucial regulator of transforming growth factor beta (TGFB1, TGFB2, and TGFB3), plays a pivotal role in controlling TGF-beta activation by maintaining it in a latent state during extracellular storage. Specifically associating with the Latency-associated peptide (LAP), the regulatory chain of TGF-beta, LRRC32 exerts its regulatory influence on integrin-dependent TGF-beta activation. Notably, LRRC32 competes effectively with LTBP1 for LAP binding, further modulating TGF-beta activation. Its significance extends to the regulation of TGF-beta-1 (TGFB1) activation on the surface of activated regulatory T-cells (Tregs). Moreover, LRRC32's involvement is essential for epithelial fusion during palate development, where it regulates the activation of TGF-beta-3 (TGFB3). Interacting directly with TGFB1, TGFB2, and TGFB3, LRRC32's association with LAP regulates the activation of TGF-beta-1 and TGF-beta-3, highlighting its intricate role in fine-tuning TGF-beta signaling. Additionally, LRRC32 interacts with LAPTM4B, contributing to the reduction of TGFB1 production in regulatory T-cells.

1. Immobilized Biotinylated Human GARP&Latent TGF beta Complex at 5 μg/mL (100μL/Well) on the plate. Dose response curve for Anti-GARP&TGF beta Antibody with the EC₅₀ of 44-45.8 ng/mL determined by ELISA.
2. Immobilized Anti-GARP&TGF beta 1 Antibody at 5μg/ml(100μl/well) on the plate. Dose response curve for Human GARP&Latent TGF Beta 1 Complex, His Tag with the EC₅₀ of 45.8ng/ml determined by ELISA.
3. Immobilized Human ITGAV&ITGB6, His Tag at 5μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human GARP&Latent TGF Beta 1 Complex, His Avi Tag with the EC₅₀ of 91.0ng/ml determined by ELISA.

Human

HEK293

C-Avi;C-8*His

Q14392 (H20-L628,GARP)&P01137 (L30-S390,Latent TGF bata 1)

2615  [NCBI]&7040  [NCBI]

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

HQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINL&LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

(73-78) kDa (GARP)&13 kDa&(42-48) kDa (Latent TGF beta 1)

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.