1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Glucagon Receptor
  5. GCGR/Glucagon receptor Protein, Mouse (HEK293, Fc)

GCGR/Glucagon receptor Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P78702
Handling Instructions Technical Support

GCGR/glucagon receptor protein is a G protein-coupled receptor for glucagon that centrally regulates blood glucose levels. It plays a key role in the fasting response by actively regulating hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. GCGR/Glucagon receptor Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GCGR/Glucagon receptor protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GCGR/Glucagon receptor Protein, Mouse (HEK293, Fc) is 111 a.a., with molecular weight of 50-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GCGR/glucagon receptor protein is a G protein-coupled receptor for glucagon that centrally regulates blood glucose levels. It plays a key role in the fasting response by actively regulating hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. GCGR/Glucagon receptor Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GCGR/Glucagon receptor protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GCGR/Glucagon receptor Protein, Mouse (HEK293, Fc) is 111 a.a., with molecular weight of 50-65 kDa.

Background

The GCGR/Glucagon receptor Protein serves as a G-protein coupled receptor for glucagon, playing a central role in the regulation of blood glucose levels and glucose homeostasis. It actively regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis, making it a key mediator of responses to fasting. Upon ligand binding, the receptor undergoes a conformational change that initiates signaling via guanine nucleotide-binding proteins (G proteins), subsequently modulating the activity of downstream effectors such as adenylate cyclase. This modulation results in the promotion of adenylate cyclase activation. Additionally, the receptor contributes to signaling via a phosphatidylinositol-calcium second messenger system, further emphasizing its multifaceted role in glucose regulation.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q61606 (A27-K137)

Gene ID
Molecular Construction
N-term
GCGR (A27-K137)
Accession # Q61606
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Glucagon R; GCGR; Glucagon receptor
AA Sequence

AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAK

Molecular Weight

50-65 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GCGR/Glucagon receptor Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GCGR/Glucagon receptor Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GCGR/Glucagon receptor Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P78702
Quantity:
MCE Japan Authorized Agent: