1. Protéines recombinantes
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. Glial Cell Line-derived Neurotrophic Factor (GDNF)
  6. GDNF Protein, Human

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons. GDNF Protein, Human is produced in E.coil, and consists of 134 amino acids (S78-I211).

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
Échantillon gratuit   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
WB
ELISA
Cell Migration/Invasion Assay
Histological Imaging/Staining
IHC

    GDNF Protein, Human purchased from MCE. Usage Cited in: Int J Mol Sci. 2024 Sep 23;25(18):10229.  [Abstract]

    Western blotting was used to detect the protein expressions of SERPINE1 in C6 and U251 cells treated with various doses of GDNF (0, 20, 40, 80, 100 ng/mL) for 48 h.

    GDNF Protein, Human purchased from MCE. Usage Cited in: Int J Mol Sci. 2024 Sep 23;25(18):10229.  [Abstract]

    GDNF (0-100 ng/mL; 24-48 h). The contents of SERPINE1 were tested in U251 cells after 24 and 48 h of treatment with different concentrations of GDNF using ELISA kits.

    GDNF Protein, Human purchased from MCE. Usage Cited in: Int J Mol Sci. 2024 Sep 23;25(18):10229.  [Abstract]

    Transwell invasion assay was conducted to evaluate the influences of SERPINE1 knockdown on cell invasion in C6 and U251 cells after 48 h of separate treatment with 80 and 20 ng/mL GDNF.

    GDNF Protein, Human purchased from MCE. Usage Cited in: Int J Mol Sci. 2024 Sep 23;25(18):10229.  [Abstract]

    GDNF (0.1 μg for each mouse). Hematoxylin-Eosin (HE) staining of the tumor tissues was performed.

    GDNF Protein, Human purchased from MCE. Usage Cited in: Int J Mol Sci. 2024 Sep 23;25(18):10229.  [Abstract]

    GDNF (0.1 μg for each mouse). IHC staining was used to detect the levels of Ki-67, GFAP, MMP2 and MMP9.
    • Activité biologique

    • Paramètres Techniques

    • Propriétés

    • Description

    • Références

    Description

    Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human is produced in E.coil, and consists of 134 amino acids (S78-I211).

    Background

    Glial cell line-derived neurotrophic factor (GDNF) is a 134 amino acid protein belonging in the GDNF family ligands (GFLs). GDNF protein is widely distributed throughout both the central and peripheral nervous systems. Synthesis and secretion of GDNF occur in many cell types such as glial cells like astrocytes, oligodendrocytes, and Schwann cells; motor neurons (MNs); and skeletal muscle[1].
    Mature human GDNF shares 91-92% amino acid sequence identity with mouse, rat, and Canine GDNF proteins. While, mouse GDNF shares 99% aa sequence identity with rat GDNF protein.
    GDNF is originally isolated from cultured B49 rat glial cells and found to enhance the survival and differentiation of dopaminergic neurons in primary cultures by promoting dopamine uptake. Similar to other members of the TGF-β superfamily, GDNF is first synthesized as a precursor protein (pro-GDNF). After a series of protein cleavage and processing, the 211 amino acid pro-GDNF is finally converted into the active and mature form of GDNF. GDNF has the ability to trigger receptor tyrosine kinase RET phosphorylation, whose downstream effects have been found to promote neuronal health and survival. The binding of GDNF to its receptors triggers several intracellular signaling pathways which play roles in promoting the development, survival, and maintenance of neuron-neuron and neuron-target tissue interactions. The synthesis and regulation of GDNF have been shown to be altered in many diseases, aging, exercise, and addiction. The neuroprotective effects of GDNF may be used to develop treatments and therapies to ameliorate neurodegenerative diseases such as amyotrophic lateral sclerosis (ALS)[1].
    GDNF is a potent neurotrophic factor for regulating MN survival in the peripheral nervous system. GDNF prevents apoptosis of MNs during development in vivo, decreases the loss of MNs in animal models of motor neuropathy and degeneration, rescues MNs from axotomy-induced cell death, and protects MNs from chronic degeneration. Intracerebral GDNF administration exerts both protective and reparative effects on the nigrostriatal dopamine system, which may have implications for the development of new treatment strategies for Parkinson's disease[1][2].

    In Vitro

    Recombinant human GDNF (100 ng/mL; 24 hours) increases transepithelial electric resistance (TER) significantly to 2.99 of baseline (2.23-fold of controls) in Caco2 cells. GDNF contributes to IEB maturation[3].

    Activité biologique

    1.The ED50 is <5 μg/mL as measured by C6 cells in a proliferation assay.
    2.Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 for this effect is 1-8 ng/mL in the presence of Recombinant Human GFR alpha-1/GDNF R alpha-1 .

    • Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 for this effect is 1.972 ng/mL, corresponding to a specific activity is 5.07×105 units/mg in the presence of Recombinant Human GFR alpha -1/GDNF R alpha -1 .
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P39905-1 (S78-I211)

    Gene ID
    Molecular Construction
    N-term
    GDNF (S78-I211)
    Accession # P39905
    C-term
    Protein Length

    Full Length of GDNF

    Synonyms
    rHuGDNF; ATF
    AA Sequence

    SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

    Predicted Molecular Mass
    15.1 kDa
    Masse moléculaire

    Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

    Pureté
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
    2.Lyophilized from a 0.22 μm filtered solution of PBS.
    3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Livraison

    Room temperature in continental US; may vary elsewhere.

    Documentation
    Références
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Vos produits récemment consultés:

    Demande en ligne

    Your information is safe with us. * Required Fields.

    GDNF Protein, Human

     

    Requested Quantity *

    Nom du demandeur *

     

    Civilité

    Adresse e-mail *

     

    Numéro de téléphone *

    Department

     

    Nom de l'organisation *

    City

    État

    Country or Region *

         

    Remarques

    Bulk Inquiry

    Inquiry Information

    Nom du produit:
    GDNF Protein, Human
    Cat. No.:
    HY-P7182
    Quantité:
    MCE Japan Authorized Agent: