Copy Link Print Information

GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

GFRA2, also known as GDNFR-α-2, acts as a receptor for neurotrophic factor (NRTN) and promotes NRTN-induced autophosphorylation and RET receptor activation. In addition to neurotrophic factor signaling, GFRA2 can also mediate GDNF signaling through the RET tyrosine kinase. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) is the recombinant human-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) Product Image
  • GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GFRA2, also known as GDNFR-α-2, acts as a receptor for neurotrophic factor (NRTN) and promotes NRTN-induced autophosphorylation and RET receptor activation. In addition to neurotrophic factor signaling, GFRA2 can also mediate GDNF signaling through the RET tyrosine kinase. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) is the recombinant human-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

GFRA2, also known as GDNFR-alpha-2, serves as a receptor for neurturin (NRTN), facilitating the NRTN-induced autophosphorylation and activation of the RET receptor. In addition to its role in neurturin signaling, GFRA2 exhibits the capability to mediate GDNF signaling through the RET tyrosine kinase receptor. Notably, GFRA2 plays a role in the NRTN-induced phosphorylation of STAT3 at 'Ser-727,' highlighting its involvement in the activation of downstream signaling pathways. This multifaceted receptor thus contributes to the intricate cellular responses orchestrated by neurturin and GDNF through the RET receptor.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O00451-1 (S22-S441)

  • Gene ID
    2675  [NCBI]
  • Molecular Construction
    • N-term
    • GFRA2 (S22-S441)
      Accession # O00451-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    rHuGDNF family receptor alpha-2/GFRA2, His ; GDNF Family Receptor Alpha-2; GDNF Receptor Alpha-2; GDNFR-Alpha-2; GFR-Alpha-2; GDNF Receptor Beta; GDNFR-Beta; Neurturin Receptor Alpha; NRTNR-Alpha; NTNR-Alpha; RET Ligand 2; TGF-Beta-Related Neurotrophic Factor Receptor 2; GFRA2; GDNFRB; RETL2; TRNR2

  • AA Sequence

    SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNS

  • Predicted Molecular Mass

    47.8 kDa

  • Molecular Weight

    Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL

GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) Related Classifications

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) Product Image
    1/16
  • GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) Product Image