GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His)

GFRA2, also known as GDNFR-α-2, acts as a receptor for neurotrophic factor (NRTN) and promotes NRTN-induced autophosphorylation and RET receptor activation. In addition to neurotrophic factor signaling, GFRA2 can also mediate GDNF signaling through the RET tyrosine kinase. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) is the recombinant human-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) is 420 a.a., with molecular weight of ~80.0 kDa.

GFRA2, also known as GDNFR-alpha-2, serves as a receptor for neurturin (NRTN), facilitating the NRTN-induced autophosphorylation and activation of the RET receptor. In addition to its role in neurturin signaling, GFRA2 exhibits the capability to mediate GDNF signaling through the RET tyrosine kinase receptor. Notably, GFRA2 plays a role in the NRTN-induced phosphorylation of STAT3 at 'Ser-727,' highlighting its involvement in the activation of downstream signaling pathways. This multifaceted receptor thus contributes to the intricate cellular responses orchestrated by neurturin and GDNF through the RET receptor.

Human

HEK293

C-6*His

O00451 (S22-S441)

2675  [NCBI]

SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNS

Approximately 80.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.