1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TGF-beta Superfamily Neurotrophic Factors Cytokine Receptors
  4. GDNF family
  5. GFR alpha-2
  6. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His)

GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His)

Cat. No.: HY-P70192
Handling Instructions Technical Support

GFRA2, also known as GDNFR-α-2, acts as a receptor for neurotrophic factor (NRTN) and promotes NRTN-induced autophosphorylation and RET receptor activation. In addition to neurotrophic factor signaling, GFRA2 can also mediate GDNF signaling through the RET tyrosine kinase. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) is the recombinant human-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GFRA2, also known as GDNFR-α-2, acts as a receptor for neurotrophic factor (NRTN) and promotes NRTN-induced autophosphorylation and RET receptor activation. In addition to neurotrophic factor signaling, GFRA2 can also mediate GDNF signaling through the RET tyrosine kinase. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) is the recombinant human-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

GFRA2, also known as GDNFR-alpha-2, serves as a receptor for neurturin (NRTN), facilitating the NRTN-induced autophosphorylation and activation of the RET receptor. In addition to its role in neurturin signaling, GFRA2 exhibits the capability to mediate GDNF signaling through the RET tyrosine kinase receptor. Notably, GFRA2 plays a role in the NRTN-induced phosphorylation of STAT3 at 'Ser-727,' highlighting its involvement in the activation of downstream signaling pathways. This multifaceted receptor thus contributes to the intricate cellular responses orchestrated by neurturin and GDNF through the RET receptor.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O00451-1 (S22-S441)

Gene ID
Molecular Construction
N-term
GFRA2 (S22-S441)
Accession # O00451-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
rHuGDNF family receptor alpha-2/GFRA2, His ; GDNF Family Receptor Alpha-2; GDNF Receptor Alpha-2; GDNFR-Alpha-2; GFR-Alpha-2; GDNF Receptor Beta; GDNFR-Beta; Neurturin Receptor Alpha; NRTNR-Alpha; NTNR-Alpha; RET Ligand 2; TGF-Beta-Related Neurotrophic Factor Receptor 2; GFRA2; GDNFRB; RETL2; TRNR2
AA Sequence

SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNS

Predicted Molecular Mass
47.8 kDa
Molecular Weight

Approximately 60-80 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70192
Quantity:
MCE Japan Authorized Agent: