1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Glia maturation factor beta/GMFB Protein, Human

Glia maturation factor beta/GMFB Protein, Human

Cat. No.: HY-P7362
COA Handling Instructions

Glia maturation factor beta/GMFB Protein, Human is a major component of glia maturation factor family, essential in brain development and responses to stress.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $35 Get quote
10 μg $80 In-stock
50 μg $225 In-stock
100 μg $380 Get quote
500 μg $1100 Get quote
1 mg $1800 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Glia maturation factor beta/GMFB Protein, Human is a major component of glia maturation factor family, essential in brain development and responses to stress.

Background

Human Glia Maturation Factor beta (GMFB) is a major component of the GMF family and highly expressed in the rodent CNS. GMFB is essential in brain development and responses to stress. On a molecular level, GMFB can regulate cytoskeleton remodelling, act like growth factors or pro-inflammatory mediators, thus playing key roles in many different cellular processes[1].

Biological Activity

Data is not available.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P60983 (M1-H142)

Gene ID
Molecular Construction
N-term
GMFB (M1-H142)
Accession # P60983
C-term
Synonyms
rHuGMFB; GMFB
AA Sequence

MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Molecular Weight

Approximately 19.3 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Glia maturation factor beta/GMFB Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glia maturation factor beta/GMFB Protein, Human
Cat. No.:
HY-P7362
Quantity:
MCE Japan Authorized Agent: