GLO1/Glyoxalase I Protein, Mouse (His)

GLO1 is an important enzyme responsible for catalyzing the conversion of hemithiol (the product of methylglyoxal and glutathione) to S-lactoylglutathione. This enzyme activity plays a crucial role in cellular detoxification by mitigating the effects of methylglyoxal, a reactive carbonyl species. GLO1/Glyoxalase I Protein, Mouse (His) is the recombinant mouse-derived GLO1/Glyoxalase I protein, expressed by E. coli , with N-His, N-6*His labeled tag.

Glyoxalase I (GLO1), also known as lactoylglutathione lyase, is a critical enzyme involved in cellular detoxification processes. GLO1 catalyzes the conversion of hemimercaptal, a compound formed from the reaction between methylglyoxal and glutathione, into S-lactoylglutathione. This enzymatic activity is essential for clearing toxic methylglyoxal, a reactive dicarbonyl compound, and preventing its harmful effects on cellular components. Moreover, GLO1 plays a role in regulating the transcriptional activity of NF-kappa-B, potentially influencing cellular responses to inflammation. Additionally, GLO1 is required for normal osteoclastogenesis, implicating its significance in bone development and remodeling. The multifaceted functions of GLO1 underscore its importance in cellular homeostasis and its potential involvement in various physiological processes.

Measured by its ability to catalyze the formation of S-D-lactoylglutathione from the hemimercaptal adduct that forms spontaneously between methylglyoxal and reduced glutathione. The specific activity is 100.39 nmol/min/μg, as measured under the described conditions.

Mouse

E. coli

N-6*His

Q9CPU0/NP_079650.3 (A2-I184)

109801  [NCBI]

Full Length of Mature Protein

AEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIATII

Approximately 25&48 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.