1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. GLO1/Glyoxalase I Protein, Mouse (His)

GLO1/Glyoxalase I Protein, Mouse (His)

Cat. No.: HY-P75162
COA Handling Instructions

GLO1 is an important enzyme responsible for catalyzing the conversion of hemithiol (the product of methylglyoxal and glutathione) to S-lactoylglutathione. This enzyme activity plays a crucial role in cellular detoxification by mitigating the effects of methylglyoxal, a reactive carbonyl species. GLO1/Glyoxalase I Protein, Mouse (His) is the recombinant mouse-derived GLO1/Glyoxalase I protein, expressed by E. coli , with N-His, N-6*His labeled tag. The total length of GLO1/Glyoxalase I Protein, Mouse (His) is 183 a.a., with molecular weight of ~25 & 48 kDa, respectively.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $52 In-stock
10 μg $88 In-stock
50 μg $247 In-stock
100 μg $420 In-stock
500 μg $1176 In-stock
1 mg $1880 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GLO1 is an important enzyme responsible for catalyzing the conversion of hemithiol (the product of methylglyoxal and glutathione) to S-lactoylglutathione. This enzyme activity plays a crucial role in cellular detoxification by mitigating the effects of methylglyoxal, a reactive carbonyl species. GLO1/Glyoxalase I Protein, Mouse (His) is the recombinant mouse-derived GLO1/Glyoxalase I protein, expressed by E. coli , with N-His, N-6*His labeled tag. The total length of GLO1/Glyoxalase I Protein, Mouse (His) is 183 a.a., with molecular weight of ~25 & 48 kDa, respectively.

Background

Glyoxalase I (GLO1), also known as lactoylglutathione lyase, is a critical enzyme involved in cellular detoxification processes. GLO1 catalyzes the conversion of hemimercaptal, a compound formed from the reaction between methylglyoxal and glutathione, into S-lactoylglutathione. This enzymatic activity is essential for clearing toxic methylglyoxal, a reactive dicarbonyl compound, and preventing its harmful effects on cellular components. Moreover, GLO1 plays a role in regulating the transcriptional activity of NF-kappa-B, potentially influencing cellular responses to inflammation. Additionally, GLO1 is required for normal osteoclastogenesis, implicating its significance in bone development and remodeling. The multifaceted functions of GLO1 underscore its importance in cellular homeostasis and its potential involvement in various physiological processes.

Biological Activity

Measured by its ability to catalyze the formation of S-D-lactoylglutathione from the hemimercaptal adduct that forms spontaneously between methylglyoxal and reduced glutathione. The specific activity is 100.39 nmol/min/μg, as measured under the described conditions.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q9CPU0/NP_079650.3 (A2-I184)

Gene ID
Molecular Construction
N-term
His
GLO1 (A2-I184)
Accession # Q9CPU0/NP_079650.3
C-term
Synonyms
Lactoylglutathione lyase; Glyoxalase I; Glx I
AA Sequence

AEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIATII

Molecular Weight

Approximately 25&48 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GLO1/Glyoxalase I Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLO1/Glyoxalase I Protein, Mouse (His)
Cat. No.:
HY-P75162
Quantity:
MCE Japan Authorized Agent: