GLP-1/GCG Protein, Human (HEK293, His)

GLP-1/GCG proteins play a key role in glucose metabolism and influence blood glucose levels. As a counterregulatory hormone to insulin, it increases gluconeogenesis and stimulates glucose-dependent insulin release, thereby affecting insulin secretion. GLP-1/GCG Protein, Human (HEK293, His) is the recombinant human-derived GLP-1/GCG protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GLP-1/GCG Protein, Human (HEK293, His) is 160 a.a., with molecular weight of ~19.0 kDa.

GLP-1/GCG Protein assumes a pivotal role in glucose metabolism and homeostasis, orchestrating a range of functions to regulate blood glucose levels. As a counterregulatory hormone to insulin, it increases gluconeogenesis while decreasing glycolysis, playing a crucial role in elevating plasma glucose levels during insulin-induced hypoglycemia. Additionally, GLP-1/GCG is a potent stimulator of glucose-dependent insulin release and responds to IL6, further influencing insulin secretion. Beyond its impact on glucose dynamics, it plays significant roles in gastric motility, suppressing plasma glucagon levels, and may contribute to the modulation of satiety and glucose disposal in peripheral tissues, independently of insulin actions. The protein also exhibits growth-promoting activities on intestinal epithelium and is implicated in the regulation of the hypothalamic pituitary axis (HPA), influencing the secretion of LH, TSH, CRH, oxytocin, and vasopressin. Notably, GLP-1/GCG increases islet mass by stimulating islet neogenesis and pancreatic beta cell proliferation, while concurrently inhibiting beta cell apoptosis, suggesting its multifaceted contributions to glucose homeostasis and overall metabolic regulation.

Human

HEK293

C-6*His

P01275 (R21-K180)

2641  [NCBI]

RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Approximately 19.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 1 mM DTT, 50% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.