1. Recombinant Proteins
  2. Viral Proteins
  3. RSV Proteins
  4. RSV G proteins
  5. glycoprotein/G Protein, HRSV (258a.a, HEK293, His)

glycoprotein/G Protein, HRSV (258a.a, HEK293, His)

Cat. No.: HY-P75818
Handling Instructions Technical Support

RSV G protein is a type II, highly glycosylated membrane protein with a full length of 292-319 amino acids (AA), an intracellular cytoplasmic tail (AA 1-37), and a transmembrane domain (AA 38 -66) and the extracellular domain ending in its carboxyl terminus.The RSV G protein has broad effects on the biology of RSV infection as well as host immune responses and infection-associated diseases.glycoprotein/G Protein, HRSV (HEK293, His) is the recombinant Virus-derived glycoprotein/G protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RSV G protein is a type II, highly glycosylated membrane protein with a full length of 292-319 amino acids (AA), an intracellular cytoplasmic tail (AA 1-37), and a transmembrane domain (AA 38 -66) and the extracellular domain ending in its carboxyl terminus.The RSV G protein has broad effects on the biology of RSV infection as well as host immune responses and infection-associated diseases.glycoprotein/G Protein, HRSV (HEK293, His) is the recombinant Virus-derived glycoprotein/G protein, expressed by HEK293 , with C-His labeled tag.

Background

The G protein backbone contains 289 to 299 amino acids (32-33 kDa), depending on the strain, and is palmitoylated. It has no sequence homology with other paramyxovirus attachment proteins, and no hemagglutinating or neuraminidase functions. The G protein has 30-40 O-linked glycans and 4-5 N-linked glycans. The central region of the G protein contains a 13-amino acid highly conserved domain, partially overlapping the cysteine noose domain with 4 cysteines linked 1-4 and 2-3, followed by a highly basic heparin-binding domain (HBD). The HBD is the likely attachment site for heparan sulfate (HS) found on the surface of most cells. A peptide from the G protein HBD (amino acids 184-198) binds efficiently to HEp-2 cells and inhibits RSV infection[1].
The G protein is ~32 kDa without post-translational processing, ~95 kDa when fully glycosylated in Hep-2 cells, ~55 kDa cells after glycosylation and cleavage in Vero cells, and ~170 kDa after post-translational processing in primary human bronchial epithelial cells. G plays an important role in the first step of infection, binding to cell surface molecules through GAGs and/or CX3CR1. Second, G modulates host responses to infection which, in turn, affect immunity and disease. Third, the G-CX3CR1 interaction contributes to both binding to cells and modulating the host response to infection[2].

Species

Virus

Source

HEK293

Tag

C-His

Accession

AII22117 (S64-K321)

Gene ID

/

Molecular Construction
N-term
HRSV G (S64-K321)
Accession # AII22117
His
C-term
Protein Length

Partial

Synonyms
Human respiratory syncytial virus (RSV) Glycoprotein G Protein
AA Sequence

SANHKVTLTTAIIQDATNQIKNTTPTYLTQNPQLGISFSNLSGTTSQSTTILASTTPSAESTPQSTTVKIKNTTTTQILPSKPTTKQRQNKPQNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLNTTKKDPKPQTTKPKEVLTTKPTGKPTINTTRTNIRTTLLTSNTKGNPEHTSQEETLHSTTSEGYPSPSQVYTTSGQEETLHSTTSEGYPSPSQVHTTSEYLSQSLSSSNTTK

Molecular Weight

29.59 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

glycoprotein/G Protein, HRSV (258a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

glycoprotein/G Protein, HRSV (258a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
glycoprotein/G Protein, HRSV (258a.a, HEK293, His)
Cat. No.:
HY-P75818
Quantity:
MCE Japan Authorized Agent: