1. Recombinant Proteins
  2. Others
  3. Glypican-2/GPC2 Protein, Human (HEK293, Fc)

Glypican-2/GPC2 is a cell surface proteoglycan that interacts with PTN to promote neurite outgrowth. Heparan sulfate of GPC2 binds PTN, releasing PTPRS from CSPG, thereby enabling PTPRS to bind GPC2. Glypican-2/GPC2 Protein, Human (HEK293, Fc) is the recombinant human-derived Glypican-2/GPC2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Glypican-2/GPC2 Protein, Human (HEK293, Fc) is 530 a.a., with molecular weight of ~35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Glypican-2/GPC2 is a cell surface proteoglycan that interacts with PTN to promote neurite outgrowth. Heparan sulfate of GPC2 binds PTN, releasing PTPRS from CSPG, thereby enabling PTPRS to bind GPC2. Glypican-2/GPC2 Protein, Human (HEK293, Fc) is the recombinant human-derived Glypican-2/GPC2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Glypican-2/GPC2 Protein, Human (HEK293, Fc) is 530 a.a., with molecular weight of ~35 kDa.

Background

The Glypican-2/GPC2 protein, a cell surface proteoglycan bearing heparan sulfate, is implicated in functions related to the motile behaviors of developing neurons. Through its heparan sulfate, GPC2 interacts with PTN, promoting neurite outgrowth by facilitating the binding of PTN with chondroitin sulfate of proteoglycans. This, in turn, releases PTPRS of chondroitin sulfate proteoglycans (CSPGs), allowing PTPRS to bind with heparan sulfate of GPC2. Additionally, the interaction of GPC2's heparan sulfate chain with MDK is inhibited by heparin followed by chondroitin sulfate E, inducing GPC2 clustering. This clustering, facilitated by the heparan sulfate chain, induces neuronal cell adhesion and neurite outgrowth. The intricate interactions of GPC2 highlight its role in mediating crucial processes during neuronal development and suggest its involvement in modulating cell adhesion and neurite outgrowth through intricate molecular interactions.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q8N158 (S24-S553)

Gene ID
Molecular Construction
N-term
GPC2 (S24-S553)
Accession # Q8N158
hFc
C-term
Protein Length

Full Length of Glypican-2

Synonyms
Glypican 2; GPC2
AA Sequence

SEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLRVCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSEALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGLLILADKLQGPFSFELTAESIGVKISEGLMYLQENSAKVSAQVFQECGPPDPVPARNRRAPPPREEAGRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDSRMAADASLEAAPCWTGAGRGRYLPPVVGGSPAEQVNNPELKVDASGPDVPTRRRRLQLRAATARMKTAALGHDLDGQDADEDASGSGGGQQYADDWMAGAVAPPARPPRPPYPPRRDGSGGKGGGGSARYNQGRSRS

Molecular Weight

Approximately 35 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Glypican-2/GPC2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Glypican-2/GPC2 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glypican-2/GPC2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P78735
Quantity:
MCE Japan Authorized Agent: