1. Recombinant Proteins
  2. Others
  3. Glypican-2/GPC2 Protein, Rhesus macaque (HEK293, His)

Glypican-2/GPC2 Protein, Rhesus macaque (HEK293, His)

Cat. No.: HY-P78701
Handling Instructions Technical Support

Glypican-2 (GPC2) is a heparan sulfate-containing cell surface proteoglycan that may influence the motor behavior of developing neurons. Glypican-2/GPC2 Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Glypican-2/GPC2 protein, expressed by HEK293 , with C-His labeled tag. The total length of Glypican-2/GPC2 Protein, Rhesus macaque (HEK293, His) is 529 a.a., with molecular weight of 55-95 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Glypican-2 (GPC2) is a heparan sulfate-containing cell surface proteoglycan that may influence the motor behavior of developing neurons. Glypican-2/GPC2 Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Glypican-2/GPC2 protein, expressed by HEK293 , with C-His labeled tag. The total length of Glypican-2/GPC2 Protein, Rhesus macaque (HEK293, His) is 529 a.a., with molecular weight of 55-95 kDa.

Background

Glypican-2 (GPC2) Protein is a cell surface proteoglycan characterized by the presence of heparan sulfate. It may play a role in the motile behaviors of developing neurons. GPC2 interacts with Pleiotrophin (PTN) through its heparan sulfate side chains, promoting neurite outgrowth. This interaction involves the binding of PTN with chondroitin sulfate of proteoglycans, leading to the release of protein tyrosine phosphatase receptor sigma (PTPRS) from chondroitin sulfate proteoglycans (CSPGs) and subsequent binding with heparan sulfate of GPC2. Furthermore, GPC2 interacts with Midkine (MDK) through its heparan sulfate chain, inducing GPC2 clustering. This interaction is inhibited by heparin followed by chondroitin sulfate E and induces neuronal cell adhesion and neurite outgrowth.

Biological Activity

Immobilized Recombinant Human Midkine Protein at 2 μg/mL (100 μL/well) can bind Rhesus macaque Glypican 2 His with a linear range of 2-31 ng/mL.

Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

XP_001103286 (S24-S552)

Gene ID
Molecular Construction
N-term
GPC2 (S24-S552)
Accession # XP_001103286
His
C-term
Synonyms
Glypican 2; GPC2
AA Sequence

SEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLRVCPQEYTCCSSETEQRLIRETEATFRSLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSEALKVPLSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGLLILADKLQGPFSFELAAESIGVKISEGLMYLQENSAKVSAQVFQECGPPHPVPARNRRAPPPQEAGRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARQSLTVCGDSRMAVDASLEAAPCWTGAGRGRYLPPVVGGSLAEQVNNPELKVDTSGPDVPTRRRRLQLRAATARMKAAALGHDLDGQDADEDASGSGGGQQYADDWMAGAVAPPARPPRPPYPPRRDGSGGKGGGGSARYNQGRSRS

Molecular Weight

55-95 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Glypican-2/GPC2 Protein, Rhesus macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Glypican-2/GPC2 Protein, Rhesus macaque (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glypican-2/GPC2 Protein, Rhesus macaque (HEK293, His)
Cat. No.:
HY-P78701
Quantity:
MCE Japan Authorized Agent: