1. Recombinant Proteins
  2. CAR-T Related Proteins
  3. GPC-3
  4. Glypican-3/GPC3 Protein, Human (201a.a, HEK293, His)

Glypican-3/GPC3 Protein, Human (201a.a, HEK293, His)

Cat. No.: HY-P704640
Handling Instructions Technical Support

The Glypican-3 (GPC3) protein is a cell surface proteoglycan that plays complex regulatory roles in key signaling pathways critical to developmental processes. Through its GPI anchoring, GPC3 negatively regulates the Hedgehog signaling pathway by competing with the Hedgehog receptor PTC1 for binding to Hedgehog protein, leading to complex internalization and subsequent lysosomal degradation. Glypican-3/GPC3 Protein, Human (201a.a, HEK293, His) is the recombinant human-derived Glypican-3/GPC3 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Glypican-3 (GPC3) protein is a cell surface proteoglycan that plays complex regulatory roles in key signaling pathways critical to developmental processes. Through its GPI anchoring, GPC3 negatively regulates the Hedgehog signaling pathway by competing with the Hedgehog receptor PTC1 for binding to Hedgehog protein, leading to complex internalization and subsequent lysosomal degradation. Glypican-3/GPC3 Protein, Human (201a.a, HEK293, His) is the recombinant human-derived Glypican-3/GPC3 protein, expressed by HEK293, with C-His labeled tag.

Background

GMP Glypican-3 (GPC3) Protein, a cell surface proteoglycan, orchestrates intricate regulatory roles in key signaling pathways crucial for developmental processes. Through its GPI-anchor, GPC3 negatively modulates the hedgehog signaling pathway by competing with the hedgehog receptor PTC1 for binding to hedgehog proteins, leading to complex internalization and subsequent lysosomal degradation. Simultaneously, it exerts positive regulation on both canonical and non-canonical Wnt signaling pathways by binding to the Wnt receptor Frizzled, enhancing the interaction between Frizzled and Wnt ligands. GPC3 binds to CD81, reducing the availability of free CD81 for binding to the transcriptional repressor HHEX, resulting in nuclear translocation of HHEX and transcriptional repression. Additionally, GPC3 inhibits the dipeptidyl peptidase activity of DPP4. Functionally, GPC3 plays pivotal roles in limb patterning, skeletal development, renal branching morphogenesis, and coronary vascular development. It also modulates the effects of growth factors BMP2, BMP7, and FGF7 on renal branching morphogenesis and contributes to the regulation of cell movements during gastrulation. GPC3 exists as a heterodimer formed by disulfide linkage and interacts with various molecules, including DPP4, FGF2, WNT5A, WNT3A, WNT7B, hedgehog proteins SHH and IHH, and Wnt receptors FZD4, FZD7, and FZD8, showcasing its pivotal role in coordinating developmental processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human Glypican 3 (359-559) Protein, His Tag at 1 μg/mL (100 μL/well) can bind Monoclonal Anti-Human GPC3 Antibody, Human IgG1 with the EC50 of 0.73 ng/ml.

Species

Human

Source

HEK293

Tag

C-His

Accession

P51654-1 (S359-H559)

Gene ID

2719

Molecular Construction
N-term
GPC3 (S359-H559)
Accession # P51654-1
His
C-term
Protein Length

Partial

Synonyms
rHuGlypican-3/GPC3, Fc; Glypican-3; GTR2-2; Intestinal protein OCI-5; MXR7; GPC3; OCI5
AA Sequence

SAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVH

Predicted Molecular Mass
24.7 kDa.
Molecular Weight

Approximately 31-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Glypican-3/GPC3 Protein, Human (201a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Glypican-3/GPC3 Protein, Human (201a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glypican-3/GPC3 Protein, Human (201a.a, HEK293, His)
Cat. No.:
HY-P704640
Quantity:
MCE Japan Authorized Agent: