Glypican-5/GPC5 Protein, Human (sf9, His)

Glypican-5 (GPC5) protein is a cell surface proteoglycan characterized by specific binding to heparan sulfate. As a proteoglycan, GPC5 consists of a core protein covalently linked to heparan sulfate chains. Glypican-5/GPC5 Protein, Human (sf9, His) is the recombinant human-derived Glypican-5/GPC5 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Glypican-5 (GPC5) protein is a cell surface proteoglycan that is distinguished by its specific association with heparan sulfate. As a proteoglycan, GPC5 consists of a core protein that is covalently attached to heparan sulfate chains. The presence of this protein on the cell surface suggests its involvement in cellular signaling and communication. Heparan sulfate chains, which are known for their ability to interact with various growth factors and other signaling molecules, likely contribute to GPC5's role in modulating signaling pathways and cellular processes. The unique characteristics of GPC5, including its association with heparan sulfate, suggest its significant contribution to cellular functions and highlight its potential as a target for further research and therapeutic interventions.

Immobilized human GPC5 at 2 μg/mL(100 μL/well) can bind human bFGF with a linear range of 0.16-14.8 ng/mL.

Human

Sf9 insect cells

C-His

P78333/NP_004457.1 (E25-T554)

2262  [NCBI]

Partial

DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGMRCYPPRGVEKPLRTLMHGQGVCTELSEIEAIQESLQTSDKDESEHPNNSFNPCSAHDHRCLQKHMAKIRDRSKMKIVGTPREEPRPVPQGSCQSELHRALERLAASQSRTHEDLFIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFQE

Approximately 60.5 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/uacc-257-cell.html  [Content Brief]