1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. GM-CSF & Receptors
  5. GM-CSF Protein, Rat (CHO)

GM-CSF Protein, Rat (CHO)

Cat. No.: HY-P7094
Handling Instructions

GM-CSF Protein, Rat (CHO) is a hematopoietic growth factor and immune modulator.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

GM-CSF Protein, Rat (CHO) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Rat

Source

CHO

Tag

Tag Free

Accession

P48750 (A18-K144)

Gene ID

116630

Synonyms
rRtGM-CSF; CSF-2; MGI-1GM; Pluripoietin-alpha; Molgramostin; Sargramostim
AA Sequence

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Molecular Weight

16-26 kDa

Biological Activity
The ED50 is <5 pg/mL as measured by FDC-P1 cells, corresponding to a specific activity of >2 × 108 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF) is produced by a variety of cell types including T cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. It is an important hematopoietic growth factor and immune modulator. GM-CSF also has profound effects on the functional activities of various circulating leukocytes. GM-CSF stimulates multipotent progenitor cells depending on its concentration, the proliferation of macrophage progenitors at the lowest doses, followed by granulocyte, erythroid, eosinophil, megakaryocyte and multipotent progenitors. It also stimulates the differentiation of myeloid leukemic cells and controls eosinophil function in some instances[1][2]. GM-CSF also enhances the functionality of mature cells, such as neutrophils. In neutrophils, GM-CSF potentiates degranulation, the release of oxygen and nitrogen radical ions, phagocytosis, and inhibits apoptosis[3]. GM-CSF inhibition in some animal models of autoimmune diseases showed significant beneficial effects[4]. GM-CSF also has many pro-inflammatory functions and recent data implicates GM-CSF as a key factor in Th17 driven autoimmune inflammatory conditions[5].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Rat (CHO)
Cat. No.:
HY-P7094
Quantity:
MCE Japan Authorized Agent: