1. Recombinant Proteins
  2. Cytokines and Growth Factors GMP-grade Proteins
  3. EGF Superfamily
  4. EGF
  5. GMP EGF Protein, Human

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. GMP EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.

GMP-grade recombinant proteins are produced under independent QA supervision, as well as quality records and full traceability.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. GMP EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.

Background

GMP EGF Protein emerges as a potent stimulator of the growth of diverse epidermal and epithelial tissues in both in vivo and in vitro environments, along with fostering the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesiotropic hormone, driving magnesium reabsorption in the renal distal convoluted tubule through the engagement of EGFR and activation of the magnesium channel TRPM6. Notably, GMP EGF Protein possesses the capability to induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro. Its molecular interactions include binding to EGFR, thereby promoting EGFR dimerization, and interacting with RHBDF2, suggesting involvement in diverse cellular processes. Furthermore, GMP EGF Protein engages with RHBDF1, potentially influencing the retention of EGF in the endoplasmic reticulum and regulating its degradation through endoplasmic reticulum-associated degradation (ERAD).

In Vitro

EGF Protein, Human (0-500 ng/mL, 72 h) promotes the proliferation of NIH 3T3 cells[3].

In Vivo

EGF Protein (Human) (10 μg/g, cream, a single dose for 7 days) reduces inflammatory infiltrate and results in wound re-epithelialization in rats with full thicknessskin wounds[1].
EGF Protein (Human) (50 μg/g, cream, every 24 h for 7 days) significantly stimulates re-epithelialization at high levels, preferably in combination with a protease inhibitor in pigs with thickness wounds on the back[1].
EGF Protein (Human) (30 μg/kg, s.c., daily for 3 weeks) attenuates the oesophageal damage normally caused by the sclerotherapy (surgical dilation of the oesophagus) procedure in Gottingen minipigs[1].

Biological Activity

The specific activity is > 1×106 IU/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01133-1 (N971-R1023)

Gene ID
Molecular Construction
N-term
GMP EGF (N971-R1023)
Accession # P01133-1
C-term
Protein Length

Full Length of EGF

Synonyms
Pro-epidermal growth factor; EGF; Urogastrone
AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Predicted Molecular Mass
6.2 kDa
Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 200 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

GMP EGF Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GMP EGF Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP EGF Protein, Human
Cat. No.:
HY-P7109G
Quantity:
MCE Japan Authorized Agent: