GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R) is the recombinant human-derived LR3 IGF-I/IGF-1 protein, expressed by E. coli , with tag free.

The LR3 IGF-I/IGF-1 protein, structurally and functionally akin to insulin, boasts significantly heightened growth-promoting activity compared to its counterpart. Positioned as a potential physiological regulator, LR3 IGF-I may govern [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts, demonstrating effective stimulation of glucose transport in bone-derived osteoblastic (PyMS) cells even at markedly lower concentrations than insulin. Its multifaceted roles extend to potential involvement in synapse maturation and the Ca(2+)-dependent exocytosis essential for sensory perception of smell in the olfactory bulb. Operating as a ligand for IGF1R, LR3 IGF-I binds to the alpha subunit, initiating the activation of intrinsic tyrosine kinase activity, autophosphorylating tyrosine residues in the beta subunit. This activation triggers a cascade of downstream signaling events leading to the activation of the PI3K-AKT/PKB and Ras-MAPK pathways. Further, LR3 IGF-I forms crucial ternary complexes with integrins (ITGAV:ITGB3 and ITGA6:ITGB4) and IGFR1, essential for comprehensive IGF1 signaling, influencing the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2, and AKT1. It also exhibits diverse molecular interactions, including with SH2D3C isoform 2.

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells.The specific activity is > 1×10⁶ U/mg.

Human

E. coli

Tag Free

P05019-1 (G49-A118, E51R, with a 13 amino acid extension peptide at the N terminal)

3479  [NCBI]

Full Length of Isoform-1 Mature Protein

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Approximately 11 KDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc-HAc, 4% mannitol, pH 4.5.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/rko-cell.html  [Content Brief]