GOLM1 Protein, Human (His, Solution)

GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (His, Solution) is the recombinant human-derived GOLM1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GOLM1 Protein, Human (His, Solution) is 366 a.a., with molecular weight of ~60 kDa.

GOLM1, while not fully understood, emerges as a cellular response protein to viral infections. Its precise role in this context remains elusive, reflecting the complexity of its functions in cellular processes. Notably, GOLM1 engages in interactions with DYM, hinting at potential associations with pathways related to cellular dynamics or host-virus interactions. The intricate nature of GOLM1's involvement in viral responses underscores the need for further investigation to unravel its specific contributions and implications in the cellular defense mechanisms against viral infections.

Data is not available.

Human

E. coli

N-6*His

Q8NBJ4 (S36-L401)

51280  [NCBI]

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Approximately 60 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, pH 7.4, 50% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.