envelope glycoprotein gp120 Protein, HIV-1 (AAC57427, HEK293 , His)

envelope glycoprotein gp120 Protein is a glycoprotein exposed on the surface of the HIV envelope.Gp120 is essential for viral infection as it facilitates HIV entry into the host cell.gp120 may also be facilitating viral persistence and continuing HIV infection by influencing the T cell immune response to the virus.envelope glycoprotein gp120 Protein, HIV-1 (AAC57427, HEK293, His) is the recombinant Virus-derived envelope glycoprotein gp120 protein, expressed by HEK293 , with C-His labeled tag.

envelope glycoprotein gp120 (gp120) is a glycoprotein exposed on the surface of the HIV envelope. Gp120 is essential for viral infection as it facilitates HIV entry into the host cell and it plays a vital role in attachment to specific cell surface receptors. These receptors are DC-SIGN, Heparan Sulfate Proteoglycan and a specific interaction with the CD4 receptor, particularly on helper T-cells. gp120 may also be facilitating viral persistence and continuing HIV infection by influencing the T cell immune response to the virus. Several mechanisms may be involved in this process of which gp120 binds to the CD4 receptor of T cells which facilitates viral entry into the CD4+ cells and their depletion. Gp120 is shed from the viral membrane and accumulates in lymphoid tissues in significant amounts. It can induce apoptosis and severely alter the immune response to the virus by dampening the antiviral CTL response thus impeding the clearance of HIV^[1].

Virus

HEK293

C-His

AAC57427 (T31-R509)

/

Partial

TEKLWVTVYYGVPVWREATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLGNVTENFNMWKNNMVDQMHEDIISLWDESLKPCVKLTPLCVTLNCTNLNITKNTTNLTSSSWGMMEEGEIKNCSFYITTSIRNKVKKEYALFNRLDVVPVKNTSNTKYRLISCNTSVITQACPKVSFQPIPIHYCVPAGFAILKCNNKTFNGSGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEDIVIRSEDFTDNVKTIIVQLNESVVINCTRPNNNTRERLSIGPGRAFYARRNIIGDIRQAHCNISRAKWNNTLQQIVIKLREKFRNKTIAFNQSSGGDPEIVMHSFNCGGEFFYCNTAQLFNSTWNVAGGTNGTEGNDIITLQCRIKQIINMWQKVGKAMYAPPITGQIRCSSNITGLLLTRDGGNSTETETEIFRPGGGDMRDNWRSELYKYKVVRIEPIGVAPTRAKRRTVQREKR

Approximately 55.4 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.