1. Recombinant Proteins
  2. Viral Proteins
  3. HIV Proteins
  4. HIV-1 gp120
  5. envelope glycoprotein gp120 Protein, HIV-1 (AFM77980, HEK293, His)

envelope glycoprotein gp120 Protein, HIV-1 (AFM77980, HEK293, His)

Cat. No.: HY-P74119
Handling Instructions Technical Support

envelope glycoprotein gp120 Protein is a glycoprotein exposed on the surface of the HIV envelope.Gp120 is essential for viral infection as it facilitates HIV entry into the host cell.gp120 may also be facilitating viral persistence and continuing HIV infection by influencing the T cell immune response to the virus.envelope glycoprotein gp120 Protein, HIV-1 (AFM77980, HEK293, His) is the recombinant Virus-derived envelope glycoprotein gp120 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

envelope glycoprotein gp120 Protein is a glycoprotein exposed on the surface of the HIV envelope.Gp120 is essential for viral infection as it facilitates HIV entry into the host cell.gp120 may also be facilitating viral persistence and continuing HIV infection by influencing the T cell immune response to the virus.envelope glycoprotein gp120 Protein, HIV-1 (AFM77980, HEK293, His) is the recombinant Virus-derived envelope glycoprotein gp120 protein, expressed by HEK293 , with C-His labeled tag.

Background

envelope glycoprotein gp120 (gp120) is a glycoprotein exposed on the surface of the HIV envelope. Gp120 is essential for viral infection as it facilitates HIV entry into the host cell and it plays a vital role in attachment to specific cell surface receptors. These receptors are DC-SIGN, Heparan Sulfate Proteoglycan and a specific interaction with the CD4 receptor, particularly on helper T-cells. gp120 may also be facilitating viral persistence and continuing HIV infection by influencing the T cell immune response to the virus. Several mechanisms may be involved in this process of which gp120 binds to the CD4 receptor of T cells which facilitates viral entry into the CD4+ cells and their depletion. Gp120 is shed from the viral membrane and accumulates in lymphoid tissues in significant amounts. It can induce apoptosis and severely alter the immune response to the virus by dampening the antiviral CTL response thus impeding the clearance of HIV[1].

Species

Virus

Source

HEK293

Tag

C-His

Accession

AFM77980 (A29-E502)

Gene ID

/

Molecular Construction
N-term
HIV-1 gp120 (A29-E502)
Accession # AFM77980
His
C-term
Protein Length

Partial

Synonyms
Envelope glycoprotein gp160; Env polyprotein; gp120; gp41; env
AA Sequence

AVGNLWVTVYYGVPVWKGATTTEFCASDAKAYDTEVHNVWATHACVPADPNPQEMVLENVTENFNMWKNEMVNQMQEDVISLWDQSLKPCVKLTPLCVTLECRNVSSNQDTYHETYHESMKEMKNCSFNATTVVEDRKQTVYALFYRLDIVPLTKKNYEKNSQEYYRLINCNTSAITQACPKVTFDPIPIHYCTPAGYAILKCNDKIFNRTQPCYNVSTVQCTHGIKPVVSTQLLLNGSLAEGEIIIRSENLTNNVKTIIVHLNQSVEIVCTRPGNNTRKSIRIGPGQTFYATGDIIGDIRQAHCNISEDKWNETLQRVSKKLAEHFQNKTIKFASSSGGDLEVTTHSFNCRGEFFYCNTSGLFNGAYTPNGTKSNSSSIITIPCRIKQIINMWQEVGRAMYAPPIKGNITCKSNITGLLLVRDGGTEPNDTETFRPGGGDMRNNWRSELYKYKVVEIKPLGVAPTTTKRRVVE

Predicted Molecular Mass
54.8 kDa
분자량

Approximately 70-120 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

envelope glycoprotein gp120 Protein, HIV-1 (AFM77980, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

envelope glycoprotein gp120 Protein, HIV-1 (AFM77980, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
envelope glycoprotein gp120 Protein, HIV-1 (AFM77980, HEK293, His)
Cat. No.:
HY-P74119
수량:
MCE Japan Authorized Agent: