Growth Hormone R/GHR Protein, Human (Biotinylated, HEK293, His)

Growth Hormone R (GHR) is the receptor for pituitary growth hormone, crucial in postnatal body growth regulation. Binding to its ligand activates the JAK2/STAT5 pathway, facilitating intracellular signaling. The soluble form, GHBP (Growth Hormone Binding Protein), acts as a growth hormone reservoir in the bloodstream. GHBP may modulate or inhibit growth hormone signaling, contributing to intricate growth process regulation. Growth Hormone R/GHR Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag.

Growth Hormone R (GHR) functions as the receptor for pituitary gland growth hormone, playing a pivotal role in the regulation of postnatal body growth. Upon binding to its ligand, GHR activates the JAK2/STAT5 pathway, facilitating the intracellular signaling cascade. Additionally, the soluble form of the receptor, known as GHBP (Growth Hormone Binding Protein), serves as a reservoir for growth hormone in the bloodstream. GHBP may also exert modulatory or inhibitory effects on growth hormone signaling, contributing to the intricate regulation of growth processes.

Human

HEK293

C-His

P10912-1 (A27-Y264)

2690  [NCBI]

Partial

Biotin

AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

Approximately 38-55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.