1. Recombinant Proteins
  2. Receptor Proteins
  3. Growth Hormone R/GHR Protein, Human (HEK293, hFc)

Growth Hormone R/GHR Protein, Human (HEK293, hFc)

Cat. No.: HY-P72024
Handling Instructions Technical Support

Growth Hormone R (GHR) is the receptor for pituitary growth hormone, crucial in postnatal body growth regulation. Binding to its ligand activates the JAK2/STAT5 pathway, facilitating intracellular signaling. The soluble form, GHBP (Growth Hormone Binding Protein), acts as a growth hormone reservoir in the bloodstream. GHBP may modulate or inhibit growth hormone signaling, contributing to intricate growth process regulation. Growth Hormone R/GHR Protein, Human (HEK293, hFc) is the recombinant human-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
2 μg 해외재고보유
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
> 500 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Growth Hormone R (GHR) is the receptor for pituitary growth hormone, crucial in postnatal body growth regulation. Binding to its ligand activates the JAK2/STAT5 pathway, facilitating intracellular signaling. The soluble form, GHBP (Growth Hormone Binding Protein), acts as a growth hormone reservoir in the bloodstream. GHBP may modulate or inhibit growth hormone signaling, contributing to intricate growth process regulation. Growth Hormone R/GHR Protein, Human (HEK293, hFc) is the recombinant human-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Growth Hormone R (GHR) functions as the receptor for pituitary gland growth hormone, playing a pivotal role in the regulation of postnatal body growth. Upon binding to its ligand, GHR activates the JAK2/STAT5 pathway, facilitating the intracellular signaling cascade. Additionally, the soluble form of the receptor, known as GHBP (Growth Hormone Binding Protein), serves as a reservoir for growth hormone in the bloodstream. GHBP may also exert modulatory or inhibitory effects on growth hormone signaling, contributing to the intricate regulation of growth processes.

Biological Activity

1.Measured by its binding ability in a functional ELISA. Immobilized GH1 at 1 μg/mL can bind human GHR and the EC50 of human GHR protein is 7.006-11.72 ng/mL.
2.Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.52 ng/mL in the presence of 0.2 ng/mL GH, corresponding to a specific activity is 1.92×106 units/mg.

  • Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.52 ng/mL in the presence of 0.2 ng/mL GH, corresponding to a specific activity is 1.92×106 units/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P10912-1 (A27-Y264)

Gene ID
Molecular Construction
N-term
GHR (A27-Y264)
Accession # P10912-1
hFc
C-term
Protein Length

Partial

Synonyms
Somatotropin receptor Serum-binding protein;
AA Sequence

AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

분자량

Approximately 66-95 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6-8% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Growth Hormone R/GHR Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Growth Hormone R/GHR Protein, Human (HEK293, hFc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Growth Hormone R/GHR Protein, Human (HEK293, hFc)
Cat. No.:
HY-P72024
수량:
MCE Japan Authorized Agent: