Growth Hormone R/GHR Protein, Rat (HEK293, Fc)

Growth Hormone R/GHR Protein, a receptor for pituitary growth hormone, regulates postnatal body growth by activating the JAK2/STAT5 pathway upon ligand binding.Its soluble form, GHBP, acts as a plasma reservoir for growth hormone and potentially modulates or inhibits GH signaling.Growth Hormone R/GHR Protein, Rat (HEK293, Fc) is the recombinant rat-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag.

The Growth Hormone R (GHR) protein functions as a receptor for pituitary gland growth hormone, playing a crucial role in the regulation of postnatal body growth. Upon binding with its ligand, GHR couples to and activates the JAK2/STAT5 signaling pathway. Additionally, the soluble form of GHR, known as GHBP (Growth Hormone Binding Protein), serves as a reservoir for growth hormone in the plasma and may function as a modulator or inhibitor of growth hormone signaling. The dynamic interplay between GHR and growth hormone underscores its pivotal role in the intricate regulation of physiological processes related to body growth.

Measured by its ability to Inhibit activation of GH pathway in a Luciferase receptor Assay System.The ED₅₀ for this effect is typically 0.03-0.3 μg/mL in the presence of 50 ng/mL human growth hormone.

Rat

HEK293

C-hFc

P16310-1 (F19-R265)

25235  [NCBI]

Extracellular Domain

MDLWRVFLTLALAVSSDMFPGSGATPATLGKASPVLQRINPSLRESSSGKPRFTKCRSPELETFSCYWTEGDDHNLKVPGSIQLYYARRIAHEWTPEWKECPDYVSAGANSCYFNSSYTSIWIPYCIKLTTNGDLLDEKCFTVDEIVQPDPPIGLNWTLLNISLPGIRGDIQVSWQPPPSADVLKGWIILEYEIQYKEVNETKWKTMSPIWSTSVPLYSLRLDKEHEVRVRSRQRSFEKYSEFSEVLRVTFPQMDTLAACEEDFR

Approximately 66 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.