1. Recombinant Proteins
  2. CD Antigens
  3. Stem Cell CD Proteins Erythrocyte CD Proteins
  4. Glycophorin-A/CD235a
  5. GYPA/CD235a Protein, Mouse (HEK293, Fc)

The GYPA/CD235a protein is an important component of the ankyrin 1 complex, which maintains the stability and shape of the red blood cell membrane. As a major intrinsic membrane protein, GYPA ensures the structural integrity and function of these blood cells. GYPA/CD235a Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GYPA/CD235a protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GYPA/CD235a protein is an important component of the ankyrin 1 complex, which maintains the stability and shape of the red blood cell membrane. As a major intrinsic membrane protein, GYPA ensures the structural integrity and function of these blood cells. GYPA/CD235a Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GYPA/CD235a protein, expressed by HEK293 , with C-hFc labeled tag.

Background

GYPA, a crucial component of the ankyrin-1 complex, intricately participates in maintaining the stability and shape of the erythrocyte membrane. Serving as the major intrinsic membrane protein of erythrocytes, GYPA plays a vital role in the structural integrity and functionality of these blood cells. The N-terminal glycosylated segment, projecting outside the erythrocyte membrane, hosts MN blood group receptors, underscoring its involvement in blood group determinants. Additionally, GYPA is integral for the proper function of SLC4A1, and its presence is essential for the high activity of SLC4A1. Furthermore, GYPA serves as a receptor for influenza virus, Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175), and Hepatitis A virus (HAV). Notably, it forms homodimers and is a key constituent of the ankyrin-1 complex, working in concert with other proteins such as ANK1, RHCE, RHAG, SLC4A1, EPB42, GYPB, and AQP1 to maintain erythrocyte membrane architecture. The interaction with SLC4A1 results in the formation of a heterotetramer, highlighting the collaborative role of GYPA in the molecular organization of erythrocyte structures.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P14220 (M1-V108)

Gene ID
Molecular Construction
N-term
GYPA (M1-V108)
Accession # P14220
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Glycophorin-A; PAS-2; CD235a; glycophorin Erik; glycophorin MiI; glycophorin MiIII; glycophorin MiV; glycophorin MiX; glycophorin SAT; GPA; GPErik; GpMiIII; GPSAT; GYPA; HGpMiIII; HGpMiV; HGpMiX; HGpMiXI; HGpSta(C); MNS; CD235a; MN
AA Sequence

MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV

Predicted Molecular Mass
38.1 kDa
Molecular Weight

Approximately 68-75 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GYPA/CD235a Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GYPA/CD235a Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GYPA/CD235a Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77956
Quantity:
MCE Japan Authorized Agent: