GZMA/Granzyme A Protein, Mouse (His-B2M)

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His-B2M) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with N-6*His, N-B2M labeled tag.

Granzyme A (GZMA) is a highly abundant protease found in the cytosolic granules of cytotoxic T-cells and natural killer cells, playing a crucial role in immune defense mechanisms. When delivered into the target cell through the immunological synapse, GZMA activates caspase-independent pyroptosis. It exhibits a substrate specificity for cleavage after lysine or arginine residues. Notably, GZMA cleaves APEX1 after 'Lys-31,' disrupting its oxidative repair activity. Additionally, it targets the nucleosome assembly protein SET, cleaving it after 'Lys-189.' This cleavage event disrupts SET's nucleosome assembly activity and facilitates the translocation of the SET complex into the nucleus, where it is involved in nicking and degrading DNA. The multifunctional activities of GZMA underscore its significance in orchestrating diverse cellular processes during immune responses.

Mouse

E. coli

N-6*His;N-B2M

P11032 (I29-V260)

14938  [NCBI]

Full Length of Mature Protein

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Approximately 39.6 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.