H2BC11 Protein, Human
The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free.
Histone H2BC11 is an essential component of the nucleosome, which serves as the fundamental unit of chromatin, responsible for wrapping and compacting DNA. This compaction limits DNA accessibility to cellular machineries, impacting transcription regulation, DNA repair, replication, and chromosomal stability. Histones, including H2BC11, play a central role in these processes. The regulation of DNA accessibility involves a complex array of post-translational modifications, known as the histone code, and nucleosome remodeling. Beyond its role in chromatin organization, H2BC11 exhibits broad antibacterial activity, suggesting its potential involvement in the formation of the functional antimicrobial barrier of the colonic epithelium. Moreover, H2BC11 may contribute to the bactericidal activity of amniotic fluid, extending its functional significance beyond chromatin dynamics to host defense mechanisms against microbial threats.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P06899 (P2-K126)
-
Molecular Construction
-
N-term
-
H2BC11 (P2-K126)
Accession # P06899 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
H2BC11; Histone Cluster 1, H2bj; Prev. HIST1H2BJ; Histone 1, H2bj; Prev. H2BFR; Histone H2B.1; H2B/R; Histone H2B.R; Histone Cluster 1 H2B Family Member J; H2BJ; H2B Histone Family, Member R; H2B Clustered Histone 11; Histone H2B Type 1-J
-
AA Sequence
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
