H2BC11 Protein, Human

The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free. The total length of H2BC11 Protein, Human is 125 a.a., with molecular weight of ~13.8 kDa.

Histone H2BC11 is an essential component of the nucleosome, which serves as the fundamental unit of chromatin, responsible for wrapping and compacting DNA. This compaction limits DNA accessibility to cellular machineries, impacting transcription regulation, DNA repair, replication, and chromosomal stability. Histones, including H2BC11, play a central role in these processes. The regulation of DNA accessibility involves a complex array of post-translational modifications, known as the histone code, and nucleosome remodeling. Beyond its role in chromatin organization, H2BC11 exhibits broad antibacterial activity, suggesting its potential involvement in the formation of the functional antimicrobial barrier of the colonic epithelium. Moreover, H2BC11 may contribute to the bactericidal activity of amniotic fluid, extending its functional significance beyond chromatin dynamics to host defense mechanisms against microbial threats.

Human

E. coli

Tag Free

P06899 (P2-K126)

8970  [NCBI]

PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Approximately 13.8 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.