Haptoglobin Protein, Human (HEK293, His)

Haptoglobin captures and binds free plasma hemoglobin, preventing kidney damage and promoting hepatic recycling of heme iron. It acts as an antioxidant, exhibits antibacterial activity, and modulates various aspects of the acute phase response. Haptoglobin Protein, Human (HEK293, His) is the recombinant human-derived Haptoglobin protein, expressed by HEK293, with C-6*His labeled tag.

The Haptoglobin protein functions to capture and bind free plasma hemoglobin, preventing kidney damage and enabling hepatic recycling of heme iron. During hemolysis, hemoglobin can accumulate in the kidneys and be secreted in urine. Additionally, Haptoglobin acts as an antioxidant, exhibits antibacterial activity, and plays a role in modulating various aspects of the acute phase response. The complexes formed between hemoglobin and Haptoglobin are efficiently cleared by the macrophage CD163 scavenger receptor on liver Kupfer cells through an endocytic lysosomal degradation pathway. Notably, the uncleaved form of the alpha-2 allele (2-2), known as zonulin, has implications in intestinal permeability by regulating intercellular tight junction disassembly and influencing the balance between tolerance and immunity to non-self antigens.

Human

HEK293

C-6*His

P00738-1 (V19-Q160&I162-N406)

3240  [NCBI]

VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ&ILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

16&40-75 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.