Copy Link Print Information

Haptoglobin Protein, Human (HEK293, His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Haptoglobin captures and binds free plasma hemoglobin, preventing kidney damage and promoting hepatic recycling of heme iron. It acts as an antioxidant, exhibits antibacterial activity, and modulates various aspects of the acute phase response. Haptoglobin Protein, Human (HEK293, His) is the recombinant human-derived Haptoglobin protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Haptoglobin Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Haptoglobin captures and binds free plasma hemoglobin, preventing kidney damage and promoting hepatic recycling of heme iron. It acts as an antioxidant, exhibits antibacterial activity, and modulates various aspects of the acute phase response. Haptoglobin Protein, Human (HEK293, His) is the recombinant human-derived Haptoglobin protein, expressed by HEK293, with C-6*His labeled tag.

Background

The Haptoglobin protein functions to capture and bind free plasma hemoglobin, preventing kidney damage and enabling hepatic recycling of heme iron. During hemolysis, hemoglobin can accumulate in the kidneys and be secreted in urine. Additionally, Haptoglobin acts as an antioxidant, exhibits antibacterial activity, and plays a role in modulating various aspects of the acute phase response. The complexes formed between hemoglobin and Haptoglobin are efficiently cleared by the macrophage CD163 scavenger receptor on liver Kupfer cells through an endocytic lysosomal degradation pathway. Notably, the uncleaved form of the alpha-2 allele (2-2), known as zonulin, has implications in intestinal permeability by regulating intercellular tight junction disassembly and influencing the balance between tolerance and immunity to non-self antigens.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P00738-1 (V19-Q160&I162-N406)

  • Gene ID
    3240  [NCBI]
  • Molecular Construction
    • N-term
    • Haptoglobin (V19-Q160&I162-N406)
      Accession # P00738-1
    • 6*His
    • C-term
  • Synonyms

    HP; Haptoglobin Alpha(2FS)-Beta; Haptoglobin; Haptoglobin Alpha(1S)-Beta; Zonulin; HP Protein; Haptoglobin, Alpha Polypeptide; HP2ALPHA2; Haptoglobin, Beta Polypeptide; HPA1S

  • AA Sequence

    VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ&ILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

  • Predicted Molecular Mass

    15.9 kDa & 28.3 kDa

  • Molecular Weight

    Approximately 16 kDa & 40-75 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Haptoglobin Protein, Human (HEK293, His) Product Image
    1/16
  • Haptoglobin Protein, Human (HEK293, His) Product Image