HB-EGF Protein, Human
Based on 3 publication(s) in Google Scholar
HB-EGF Protein, Human is a member of the epidermal growth factor (EGF) family of growth factors that stimulate growth and differentiation.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
HB-EGF Protein, Human is a member of the epidermal growth factor (EGF) family of growth factors that stimulate growth and differentiation.
Background
Heparin-binding EGF-like Growth Factor (HB-EGF) belongs to the EGF superfamily of peptide growth and differentiation factors. HB-EGF activates two EGF receptor subtypes, HER1 and HER4 and binds to cell surface HSPG. The transmembrane form of HB-EGF is a juxtacrine growth and adhesion factor and is uniquely the receptor for diphtheria toxin. HB-EGF gene expression is highly regulated, for example by cytokines, growth factors, and transcription factors such as MyoD. HB-EGF has been implicated as a participant in a variety of normal physiological processes such as blastocyst implantation and wound healing, and in pathological processes such as tumor growth, SMC hyperplasia and atherosclerosis[1].
Verified Bioactivity
The ED50 is <0.75 ng/mL as measured by 3T3 cells.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (3)
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q99075 (D63-L148)
-
Molecular Construction
-
N-term
-
HB-EGF (D63-L148)
Accession # Q99075 -
C-term
-
-
Protein Length
Full Length of Heparin-binding EGF-like growth factor Chain
-
Synonyms
HBEGF; Diphtheria Toxin Receptor (Heparin-Binding EGF-Like Growth Factor); Prev. HEGFL; Heparin-Binding Epidermal Growth Factor; Prev. DTR; Short Form Heparin-Binding EGF-Like Growth Factor; Prev. DTS; Heparin-Binding EGF-Like Growth Factor; Diphtheria To
-
AA Sequence
DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
-
Predicted Molecular Mass
9.7 kDa
-
Molecular Weight
Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized after extensive dialysis against PBS.
<1.0 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)