1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins Receptor Proteins Enzymes & Regulators
  3. HGF & Receptors c-Met/HGFR Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. HGFR Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

HGFR Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

Cat. No.: HY-P72937
Handling Instructions

HGFR Protein, a receptor tyrosine kinase, transduces signals by binding hepatocyte growth factor/HGF ligand. It regulates proliferation, scattering, morphogenesis, and cell survival. Upon ligand binding, HGFR undergoes autophosphorylation, creating docking sites for downstream molecules like PI3K, PLCG1, SRC, GRB2, STAT3, or GAB1, activating RAS-ERK, PI3K-AKT, and PLCgamma-PKC cascades. HGFR Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived HGFR protein, expressed by HEK293 , with C-His labeled tag. The total length of HGFR Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is 932 a.a., with molecular weight of ~128.2 & 77.6 & 45.7 kDa, respectively.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HGFR Protein, a receptor tyrosine kinase, transduces signals by binding hepatocyte growth factor/HGF ligand. It regulates proliferation, scattering, morphogenesis, and cell survival. Upon ligand binding, HGFR undergoes autophosphorylation, creating docking sites for downstream molecules like PI3K, PLCG1, SRC, GRB2, STAT3, or GAB1, activating RAS-ERK, PI3K-AKT, and PLCgamma-PKC cascades. HGFR Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived HGFR protein, expressed by HEK293 , with C-His labeled tag. The total length of HGFR Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is 932 a.a., with molecular weight of ~128.2 & 77.6 & 45.7 kDa, respectively.

Background

Hepatocyte growth factor receptor (HGFR), a receptor tyrosine kinase, functions as a signal transducer from the extracellular matrix by binding to hepatocyte growth factor/HGF ligand. It plays a pivotal role in regulating diverse physiological processes, including proliferation, scattering, morphogenesis, and cell survival. Upon ligand binding at the cell surface, HGFR undergoes autophosphorylation on its intracellular domain, creating docking sites for downstream signaling molecules. Upon activation by ligand, it interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, STAT3, or the adapter GAB1, leading to the activation of multiple signaling cascades, including RAS-ERK, PI3 kinase-AKT, and PLCgamma-PKC. RAS-ERK activation is associated with morphogenetic effects, while PI3K/AKT coordinates prosurvival effects. In embryonic development, HGFR signaling contributes to gastrulation, the development and migration of neuronal precursors, angiogenesis, and kidney formation. During skeletal muscle development, it is crucial for the migration of muscle progenitor cells and the proliferation of secondary myoblasts. In adults, it participates in wound healing, organ regeneration, tissue remodeling, and promotes the differentiation and proliferation of hematopoietic cells. Additionally, in the context of microbial infection, HGFR acts as a receptor for Listeria monocytogenes internalin InlB, mediating the entry of the pathogen into cells[1][2][3].

Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

C-His

Accession

NP_001162100.1 (M1-T932)

Gene ID
Molecular Construction
N-term
HGFR (M1-T932)
Accession # NP_001162100.1
His
C-term
Synonyms
Hepatocyte growth factor receptor; HGF receptor; SF receptor; MET
AA Sequence

MKAPAVLVPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETAIQNVILHEH HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPNQCPDCVVSAL GAKVLSSVKDRFINFFVGNTINSSYFPHHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE FRDSYPIKYIHAFESNNFIYFLTVQRETLNAQTFHTRIIRFCSLNSGLHSYMEMPLECIL TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRAEF TTALQRVDLFMGQFSEVLLTSISTFVKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL LDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW CHDKCVRSEECPSGTWTQQICLPAIYKVFPTSAPLEGGTRLTICGWDFGFRRNNKFDLKK TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPIIT SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLHSVSVPRMVINVH EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL LKLNSELNIEWKQAISSTVLGKVIVQPDQNFT

Molecular Weight

Approximately 128.2&77.6&45.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HGFR Protein, Cynomolgus/Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P72937
Quantity:
MCE Japan Authorized Agent: