gp140 Protein, HIV-1 (ACY40659, HEK293, Fc)

envelope glycoprotein gp120 Protein is a glycoprotein exposed on the surface of the HIV envelope.Gp120 is essential for viral infection as it facilitates HIV entry into the host cell.gp120 may also be facilitating viral persistence and continuing HIV infection by influencing the T cell immune response to the virus.gp140 Protein, HIV-1 (ACY40659, HEK293, Fc) is the recombinant Virus-derived gp140 protein, expressed by HEK293 , with C-hFc labeled tag.

envelope glycoprotein gp120 (gp120) is a glycoprotein exposed on the surface of the HIV envelope. Gp120 is essential for viral infection as it facilitates HIV entry into the host cell and it plays a vital role in attachment to specific cell surface receptors. These receptors are DC-SIGN, Heparan Sulfate Proteoglycan and a specific interaction with the CD4 receptor, particularly on helper T-cells. gp120 may also be facilitating viral persistence and continuing HIV infection by influencing the T cell immune response to the virus. Several mechanisms may be involved in this process of which gp120 binds to the CD4 receptor of T cells which facilitates viral entry into the CD4+ cells and their depletion. Gp120 is shed from the viral membrane and accumulates in lymphoid tissues in significant amounts. It can induce apoptosis and severely alter the immune response to the virus by dampening the antiviral CTL response thus impeding the clearance of HIV^[1].

Virus

HEK293

C-hFc

ACY40659 (Y38-Q684)

/

Partial

YVTVYYGVPVWRNAEVTLFCAADASLTSKEQHNIWATQACVPTDPTPIEIPINVTESFNIWKNYMVTQMQEDIISLWDQSLKPCVKLTILCVTMNCSECHREASCNNNSSSSVNXTADNPLDLFKCSFNTTTVLKDKKQGQQALFYRTDLIALNETANNTLYRLINCNTTTITQACPKVTFEPLPIQYCAPAGYALMKCNQKGFNGTGPCNQTVITHCTHGIKPTVSTQLILNGTLAEEEPLVITQNVSDTRYVIIVKLNKNVSITCVRPGNNTRGQVQIGPMTWYNMKFYTGDIRKAYCNISMQNWTETLKSVSEAIWKAYPQPPNQNHTFVFRNSTGGDPEVSFLHXNCHGEFFYCNTSTLFNYSYTCNTSGACTGKHTGENMTITLPCRLKQVVNSWMKVGSGLFAPPIEGQLQCHSNITGLILDRASPYNANSSNTTLSPTGGEMRNIWRSELYPYKVVQVKALAVAPTRVSRPTIMAHDAHRKKRGAGLGMLFLGFMSAAGSTMGAAAVTLTVQARQLLHGIVQQQNNMLRAIEAQQELLRLSVWGIRQLRARLLAIETYLRDQQLLGLWGCSGQTVCYTNVPWNRSWTNKSETELDGIWTNLTWQEWDKXVDNYTDTIYLEIQRAQDQQKANEKKLLELDQ

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Yoon V, et al. The GP120 molecule of HIV-1 and its interaction with T cells. Curr Med Chem. 2010;17(8):741-9.  [Content Brief]