p24 Protein, HIV-1 (AAB50258, His)

The capsid protein p24 forms the conical core of the genome RNA-nucleocapsid complex in the virion. Promote immune invasion by hiding the viral DNA detected by CGAS. The viral capsid protein p24 is considered to be another early virological biomarker of infection. p24 Protein, HIV-1 (AAB50258, His) is the recombinant Virus-derived p24 protein, expressed by E. coli , with C-His labeled tag. The total length of p24 Protein, HIV-1 (AAB50258, His) is 231 a.a., with molecular weight of ~27 kDa.

The Gag-Pol polyprotein assumes a central role in the virion assembly process, collaborating with the Gag polyprotein to orchestrate essential events such as binding to the plasma membrane, facilitating protein-protein interactions crucial for spherical particle formation, recruiting viral Env proteins, and packaging genomic RNA through direct interactions with the RNA packaging sequence (Psi). This polyprotein potentially regulates its own translation by binding genomic RNA in the 5'-UTR, exhibiting a dual role in promoting translation at low concentrations and encapsidating genomic RNA to inhibit translation at higher concentrations. The multipartite membrane-binding signal, including the myristoylated N-terminus, targets the polyprotein to the plasma membrane. Additionally, the Matrix protein within the polyprotein is implicated in the pre-integration complex and is associated with the release from the host cell mediated by Vpu. The ability of Gag-Pol to bind to RNA further underscores its multifaceted functions in the intricate process of virion assembly^[1][2][3][4].

Virus

E. coli

C-His

AAB50258 (P133-L363)

155030  [NCBI]

PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL

Approximately 27 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.